KEGG   Malassezia globosa: MGL_3132Help
Entry
MGL_3132          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgl  Malassezia globosa
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:mgl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgl00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mgl00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MLSFATLVSARAMARAAPRYTAAFAVASSRHFTMSTRRLGVVKVPEMAESISEGTLREWH
KKVGDYVNESDEVATIETDKIDVAVNSPESGVITELYAEAEDNVEVGKDLFKIEPGEAPK
EQPKDEGKSEEPKKDEEKSEEPKKEEPKSEEPKKEEPKKEEPKKEPKKEEPKKKDAGRQE
SEVAPKAGARTESRVKMTRMRKRIAERLKESQNTAASLTTFNEIDLSALMSFRARNKDRL
LKETGIKLGFMGAFSKACALALRDIPSANASIEGEGLGDTIVYRDYVDLGVAVSTERGLV
TPVVRNVENMGILEIENAITELGLKARDSKLSLEEMTGATFTISNGGVFGSLFGTPILNL
PGSAILGMHAIKEKPWVVNGKVEVRPIMVVALTYDHRLLDGREAVTFLVKLKQYLEDMPT
MLL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttttgccacgcttgtctcggcccgtgctatggcacgggctgcacccaggtat
acagctgcatttgcagtggcctcgagtcgtcactttaccatgtccactcgtaggctcggt
gtagtgaaggtgccggagatggccgagtcgatctccgagggcacgctgcgtgaatggcac
aaaaaggttggtgactatgtgaatgagagcgacgaggttgcgacgatcgagacggacaag
attgatgtggccgtcaactcgcccgagtcaggtgtcatcaccgagttgtacgctgaggcg
gaggacaacgtcgaggtcggcaaggacctgttcaagattgagcctggtgaggcgccaaag
gagcagcctaaggatgaaggaaagagtgaagagccaaagaaggatgaggaaaagagtgaa
gagccaaagaaggaggagccaaagagtgaagagccaaagaaggaggagccaaagaaggaa
gagccaaagaaggagccgaagaaggaagagccgaagaaaaaggacgctggcaggcaggag
agcgaagtagcaccgaaggctggtgctcgcacagagtcgcgtgttaagatgacgcgtatg
cgcaagcgcattgctgagcgcttgaaggagtcgcaaaacacggctgcatcgctgacgacg
ttcaacgagatcgacttgagtgctttgatgtcattccgtgcgcgcaacaaggaccgtctg
ctgaaggagacaggtatcaagcttggtttcatgggcgcgttctccaaagcgtgtgcgctt
gctctgcgtgacatcccatcagccaatgccagcattgaaggcgagggtcttggcgacacc
attgtataccgcgactatgtggatctcggtgtggctgtcagcacggagcgtggtctagtg
acacctgttgtgcgcaatgtcgaaaacatgggcattctggagatcgagaatgcgattacc
gaattaggccttaaggcgcgtgacagcaagctgtcgctcgaggagatgacgggtgccacc
ttcacgatctcgaatggtggtgtgtttggctccctattcggtacaccaatcctgaaccta
ccaggctctgccatcctgggtatgcatgccatcaaggagaagccgtgggtcgtgaacgga
aaggtggaagtgcgtcctatcatggttgtggctctcacgtacgaccaccgtcttctcgat
ggtcgtgaggccgtcacgttcctcgtcaagcttaagcagtacctggaggacatgcctact
atgcttttgtag

DBGET integrated database retrieval system