KEGG   Malassezia globosa: MGL_3248Help
Entry
MGL_3248          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mgl  Malassezia globosa
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:mgl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MGTKMWLEPPRTCLTKRVLGRRDAGEKAAANAASQQEQQAQSATSQSSLLPLAAQVQPDV
SQQSKNNNVDTVESGSKSTQGFSSAQSSISKPTPTTMPGVPASAPDMNMYTGLPMRNLKG
RYKLQDFTILRTLGTGSFGRVHLVQSVHNQRFYAIKVLRKQHVVKMKQVEHVNNEHSVLS
MVRHPFLVNLWGTFQDPTFLYMVMDFVPGGELFSLLRQSRRFPSQVAKFYISEVALAIDF
LHKHNIIYRDLKPENVLIGADGHLKLIDFGFAKVTAQSNGMCWTLCGTPDYLAPEVIRAR
GYNASVDWWSVGVLLFEMMAGYPPFYTEDGNPIKLYEKILAGQVHYPSFFEPGAKDLLQS
LLTADLSKRFGNLHRGSRDIFAHMWFAEIDWECLYRKEIPAPYIPNINMDGDASQFDKYP
ENDLSEYQRPNAPDEFPNIFPDF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgaagatgtggcttgagccccctcgaacctgtctgactaagcgcgttttggga
cgtcgtgatgctggagagaaggctgcagcaaatgcggcatcgcagcaagagcagcaagca
cagtctgcgacatctcagtcatcactgctgccattagcggcacaagtacagccagatgta
tcgcaacagagcaagaacaacaacgtagacacagtggagtctggctcaaaaagcacgcag
ggcttctccagtgcgcagtcatcaatatcaaaaccaacacccacaacgatgccgggcgtt
ccggccagtgcgcctgacatgaatatgtacacggggttgcccatgcggaatttgaagggc
cgatacaaactacaagacttcacgatcctacgcacactcggcacaggttcatttggccgc
gtgcatctcgtacagtccgtgcacaaccaacggttctatgcaatcaaggtgctgcgcaaa
cagcatgtcgtcaagatgaagcaagttgagcatgtgaataatgaacattccgtcctgtcg
atggtgcggcatccgttccttgtgaatctatggggtacgttccaggacccgacattcttg
tacatggtgatggactttgtgcccggtggcgagctgtttagtctgttacggcagagccgg
cgattcccatcccaagtggcgaaattctacatctcggaagtggcgcttgcgatcgacttc
ctgcacaaacacaacatcatctaccgcgatctgaagccggaaaacgtgctgatcggtgct
gacggacacctgaagctcatcgactttgggtttgccaaagtcacggcccagtccaacggt
atgtgctggacgctctgtggcacgcctgactacctggcgccggaggtaatccgcgctcgc
ggatacaatgccagtgtggactggtggtctgtgggtgtgctgcttttcgagatgatggct
ggctacccgccgttctacactgaagacggcaaccccatcaagctgtatgaaaagatcctc
gctggccaagtgcactacccgtcgttcttcgagcctggtgcgaaagatcttcttcagtcg
ctgctcacggccgatctctcgaaacgttttggtaatttgcaccgcggcagccgcgatatt
ttcgcccatatgtggtttgctgaaatcgattgggaatgtctctaccgaaaagaaatcccc
gctccctacatccctaatatcaatatggatggcgacgcaagccagttcgataagtatcct
gaaaatgatctgtccgagtaccagcgacccaatgctccagacgagttccctaacatcttc
cctgacttttag

DBGET integrated database retrieval system