KEGG   Malassezia globosa: MGL_3248Help
Entry
MGL_3248          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mgl  Malassezia globosa
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    MGL_3248
Enzymes [BR:mgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MGL_3248
Protein kinases [BR:mgl01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   MGL_3248
Messenger RNA biogenesis [BR:mgl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     MGL_3248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MGTKMWLEPPRTCLTKRVLGRRDAGEKAAANAASQQEQQAQSATSQSSLLPLAAQVQPDV
SQQSKNNNVDTVESGSKSTQGFSSAQSSISKPTPTTMPGVPASAPDMNMYTGLPMRNLKG
RYKLQDFTILRTLGTGSFGRVHLVQSVHNQRFYAIKVLRKQHVVKMKQVEHVNNEHSVLS
MVRHPFLVNLWGTFQDPTFLYMVMDFVPGGELFSLLRQSRRFPSQVAKFYISEVALAIDF
LHKHNIIYRDLKPENVLIGADGHLKLIDFGFAKVTAQSNGMCWTLCGTPDYLAPEVIRAR
GYNASVDWWSVGVLLFEMMAGYPPFYTEDGNPIKLYEKILAGQVHYPSFFEPGAKDLLQS
LLTADLSKRFGNLHRGSRDIFAHMWFAEIDWECLYRKEIPAPYIPNINMDGDASQFDKYP
ENDLSEYQRPNAPDEFPNIFPDF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgaagatgtggcttgagccccctcgaacctgtctgactaagcgcgttttggga
cgtcgtgatgctggagagaaggctgcagcaaatgcggcatcgcagcaagagcagcaagca
cagtctgcgacatctcagtcatcactgctgccattagcggcacaagtacagccagatgta
tcgcaacagagcaagaacaacaacgtagacacagtggagtctggctcaaaaagcacgcag
ggcttctccagtgcgcagtcatcaatatcaaaaccaacacccacaacgatgccgggcgtt
ccggccagtgcgcctgacatgaatatgtacacggggttgcccatgcggaatttgaagggc
cgatacaaactacaagacttcacgatcctacgcacactcggcacaggttcatttggccgc
gtgcatctcgtacagtccgtgcacaaccaacggttctatgcaatcaaggtgctgcgcaaa
cagcatgtcgtcaagatgaagcaagttgagcatgtgaataatgaacattccgtcctgtcg
atggtgcggcatccgttccttgtgaatctatggggtacgttccaggacccgacattcttg
tacatggtgatggactttgtgcccggtggcgagctgtttagtctgttacggcagagccgg
cgattcccatcccaagtggcgaaattctacatctcggaagtggcgcttgcgatcgacttc
ctgcacaaacacaacatcatctaccgcgatctgaagccggaaaacgtgctgatcggtgct
gacggacacctgaagctcatcgactttgggtttgccaaagtcacggcccagtccaacggt
atgtgctggacgctctgtggcacgcctgactacctggcgccggaggtaatccgcgctcgc
ggatacaatgccagtgtggactggtggtctgtgggtgtgctgcttttcgagatgatggct
ggctacccgccgttctacactgaagacggcaaccccatcaagctgtatgaaaagatcctc
gctggccaagtgcactacccgtcgttcttcgagcctggtgcgaaagatcttcttcagtcg
ctgctcacggccgatctctcgaaacgttttggtaatttgcaccgcggcagccgcgatatt
ttcgcccatatgtggtttgctgaaatcgattgggaatgtctctaccgaaaagaaatcccc
gctccctacatccctaatatcaatatggatggcgacgcaagccagttcgataagtatcct
gaaaatgatctgtccgagtaccagcgacccaatgctccagacgagttccctaacatcttc
cctgacttttag

DBGET integrated database retrieval system