KEGG   Malassezia globosa: MGL_3313Help
Entry
MGL_3313          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgl  Malassezia globosa
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGL_3313
   00670 One carbon pool by folate
    MGL_3313
Enzymes [BR:mgl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MGL_3313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 294 aa AA seqDB search
MRAAGGTSPLGPLPLTAIVAASLRNGIGSQGTLPWRLSKDMAYFRAVTMHVGEPVHDDEV
MDSAGCVRTPVCMKNAVIMGRHTWDSIPPKFRPLRDRINVVVSTSMTRAHLGSSECDDHD
TLIARSLDEAVALLQERRMWRYRARAEGDATLDSSDVLRGSALGHAFVIGGAALYRHLLT
STSQAWTLDSLLVTRIFTPVDLHEKCDVFLTEFRSPAQVAWEIERADTWTGRTPQPEKDA
LVCPNPDGLGAWQQATPEWHAHHYPCVLPALLGPILDDNGMAIQFQCWRRSTCV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctgcgggcggcacgtctccgctaggaccactcccgcttacggccattgtggct
gccagcttgcggaatggcatcgggtcacagggcacgctgccctggcgattgtccaaagac
atggcgtatttccgcgccgtcacaatgcacgtgggtgagcctgtccatgacgacgaggtg
atggacagcgcaggctgtgtgcggacacctgtctgcatgaaaaatgcagtcatcatggga
cggcatacgtgggacagcataccgccaaagttccgccctcttcgcgatcgaatcaatgtc
gtcgtgagcacatccatgacacgcgcgcacttgggctcatctgagtgcgatgaccacgat
accctgatcgcccgctcgcttgacgaggctgtcgctctcttgcaggagcgacgcatgtgg
cgctaccgtgctcgcgcggaaggcgatgctacgcttgattctagtgatgtcttgcgtggc
tctgccctggggcatgcatttgtcattgggggggcggctctttatcgccacctgctgacg
agcacaagtcaggcgtggacgcttgactctctgctcgtaacgcggatcttcactcctgtg
gatctgcatgaaaagtgcgatgtatttcttactgagtttcgctcacctgcccaggtagca
tgggaaatcgagcgtgctgatacatggaccgggcgcacgccgcagcccgagaaagacgcg
ctcgtgtgcccgaatccagacggtcttggcgcttggcagcaggctacacccgaatggcat
gcacatcattacccatgcgttttacctgctctactaggccccatactcgatgacaatggc
atggccattcagttccagtgttggcgccgatccacatgcgtatag

DBGET integrated database retrieval system