KEGG   Malassezia globosa: MGL_3313Help
Entry
MGL_3313          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgl  Malassezia globosa
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mgl00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 294 aa AA seqDB search
MRAAGGTSPLGPLPLTAIVAASLRNGIGSQGTLPWRLSKDMAYFRAVTMHVGEPVHDDEV
MDSAGCVRTPVCMKNAVIMGRHTWDSIPPKFRPLRDRINVVVSTSMTRAHLGSSECDDHD
TLIARSLDEAVALLQERRMWRYRARAEGDATLDSSDVLRGSALGHAFVIGGAALYRHLLT
STSQAWTLDSLLVTRIFTPVDLHEKCDVFLTEFRSPAQVAWEIERADTWTGRTPQPEKDA
LVCPNPDGLGAWQQATPEWHAHHYPCVLPALLGPILDDNGMAIQFQCWRRSTCV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctgcgggcggcacgtctccgctaggaccactcccgcttacggccattgtggct
gccagcttgcggaatggcatcgggtcacagggcacgctgccctggcgattgtccaaagac
atggcgtatttccgcgccgtcacaatgcacgtgggtgagcctgtccatgacgacgaggtg
atggacagcgcaggctgtgtgcggacacctgtctgcatgaaaaatgcagtcatcatggga
cggcatacgtgggacagcataccgccaaagttccgccctcttcgcgatcgaatcaatgtc
gtcgtgagcacatccatgacacgcgcgcacttgggctcatctgagtgcgatgaccacgat
accctgatcgcccgctcgcttgacgaggctgtcgctctcttgcaggagcgacgcatgtgg
cgctaccgtgctcgcgcggaaggcgatgctacgcttgattctagtgatgtcttgcgtggc
tctgccctggggcatgcatttgtcattgggggggcggctctttatcgccacctgctgacg
agcacaagtcaggcgtggacgcttgactctctgctcgtaacgcggatcttcactcctgtg
gatctgcatgaaaagtgcgatgtatttcttactgagtttcgctcacctgcccaggtagca
tgggaaatcgagcgtgctgatacatggaccgggcgcacgccgcagcccgagaaagacgcg
ctcgtgtgcccgaatccagacggtcttggcgcttggcagcaggctacacccgaatggcat
gcacatcattacccatgcgttttacctgctctactaggccccatactcgatgacaatggc
atggccattcagttccagtgttggcgccgatccacatgcgtatag

DBGET integrated database retrieval system