KEGG   Malassezia globosa: MGL_3371Help
Entry
MGL_3371          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mgl  Malassezia globosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGL_3371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1974 aa AA seqDB search
MASVAGDVNVFEPARFESLYDTIHTVTTVPDACVHDWYLNVERNRSPLTNLGRVRAPNEA
ERRDISKGVIVLGGQSQTLNADFVAQTLLLSDELHVSETYAASLLQEGIAARARWGRSPS
EVACLLYYRERLALLACLKELARGTYTLCVGGDLRTGIRMSRLLDDLVSGDVLVQNLLVE
LDTLRAERERVRTSMQKPPSANARLSDEVQMERLTWISQAEQELGHVAYLLALARRLVPS
AIEAVMTFLSKATLPPVESAASVPTTSVYLMTAVLAVFDTVPDEAGEWLAQHSTAPLCTA
EALCGDVRCLQALLRSVSQSAWATPGLQHVVQLQLALFLTDALTSHTTLAPALGQSADDV
QLLASRAITADGDASALLFLLLRVLSFRRAPEDELDVDEVAPAAMDVEFQEYVLQQVEHL
VLGLTTTCFPLLRKLQRAEEDAAISVLRASSRPVTGAGVSAGSLGSSGTGAGGAPLARRY
DIEAFFDLVALLCRGRPESGLAFWQGPDRRISRFLLWAVDTRELGQQRAFLGMLASLAEG
EQCAAYAHALLEHDAGAPAGSERRLVTWTRLFEWMAHYIEAFQRHAVAVMPPDELVLLRA
FLNVLATVVRYSAATRDALFWHKEYMPVDRLFSLYACAVPMDLKAAILRAIGAFAVQSGT
STSARIVTVLWERLNLSGAVRSVRGEPPRALYELENVECVHGRFPSTHALVDLLSAIVPH
VAPASQADTLVAYMRDASLPWWHSGRNSTTASSTTASTSHGSGNSMSTSMYVAYVLDHVL
LPASNRTYARPAERWAISASCLEFAEKCLATLPVAPVDTAHPGFDVLRRLLSGTPLLREL
FFFVHPDPSCAGYEVINMNRAQTPDFSRAVRAALRILLRMLEVQNDVLHNVPSINDHAAV
KDRALFLALDVHLLQAHQVVVQIALYILCVDTEIAWLAVRLLGALARTSTFQATDAFGPL
RARTSRNRLAGLLDMAGETARVTSGVLAWLEADTGMDADSDNLNYDADVNGNYHAPGTTA
HMDMSSSLSDADGVASLNDTATGILPAKIQKELLDLFLEQLVPDAPAPNVAHLLLGFDMD
ASDPDRLVHESRDAILLTLVQRVTPPCTWPPTLAERCYAVLQRACVHPYTSASMLRFLRT
HDFVATQLRSLPLVPLSVTSSSSATGPSFGTLMYASGETVSTRTEWALALLRTHAHILSL
VALELHTLAAHGQLQRAVPLMTLLLGEPVMHGTGGGSGRWRPLLEATHVTWENAAEDSVS
EPKWVAARLAPALVPDTASAARVYDIHEVAALLLEERGTQEHTVWFEQARRILLWAAAQN
TRRAFAYARREAFIAWRQVMEVLVGQALTTVVRADVRVPILLDCANALLPRLQDQDDALV
PSIAASTILSLLHAVREHEDVPAERLVLIVRAILDVLSFGTQASTRCDLYLSLVCAQQLV
CSRSSVSHGGRAAAAHRVYSLFATHAAHLVNVLARDALDGSDVAQTVSLTTLSHLVAWDG
ASSTASSPSPASASVLPALHIGEKLASAGFLKSLALRIHELDVPLQATLTPDPPSLNALY
VYEALLSVLGRLARSKASLLLEARIVDVLARVDFPSLRPEHTLDDMDGFLPPVAERYASL
LMPLLQLLVTLLMSVPQARESVHAVLVAHQDAFLAALHAATHSSAGTGDVEQAALLVQIL
TFMTPPLLPTPPPFHAACLALAATYLVPNAHEALKPLTLAEREDASIFAPTYNGLVQTAP
DARLTLFDASARRVVDRLARALVQYMELASSHGEARAILVPSMHVARVSDHASSAARIVA
APSLGVAIAALGEQCASVALALSSLDRVNALLRDPESVHADEWTDMAQDAGLLSLSASSA
LTMQCRAACEKALDCVSKDLTATVLAKLDMIERWLVMLVRHLDLFMRIGGASRASFDAAA
LRSSANAALLPILDDQLAYLTVPSHLVPSADEHVTFLHISARRVAERLLETSPL
NT seq 5925 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggtggccggcgacgtgaatgtgtttgaaccagcgcgcttcgaatcgctctat
gacaccatacacactgtgacaacggtgccagatgcttgtgtacatgactggtacttgaat
gttgagcggaatcggagtcctctcaccaatctaggacgtgtgcgtgcgccaaatgaggca
gagcgtcgagatatctcgaagggtgtgattgtgctgggtgggcagtcacagacgctgaat
gctgattttgttgctcagacgcttctcttgtctgatgaattgcatgtgtcggagacgtat
gctgcatcccttctgcaggagggaatcgccgcgcgtgcgcgctggggccgctcaccatca
gaagttgcgtgtctattatactaccgtgagcgtctggcgctccttgcatgcctgaaggaa
ctcgctcgtggcacatataccctgtgtgtcggtggtgatctgcgaacaggcattcggatg
agccgtcttcttgacgatcttgtatctggcgatgtgctcgtgcagaacctgctcgtggag
ctggatacgctccgtgcagagcgcgagcgcgtgcgtacgtcgatgcaaaagccaccatcg
gccaatgcacgacttagtgacgaggttcagatggagcgcttgacgtggatcagtcaggct
gagcaagagcttggtcatgttgcatacctgttagcgctagcgcgacgactagtgcctagt
gccatcgaggccgtcatgacattcctgagcaaggccacactgcctccggtcgagtctgcg
gcatcggtgcctacgacaagtgtatacttgatgacggctgtgcttgccgtcttcgacaca
gtcccggacgaagcgggtgaatggctcgcacagcacagcacagcgccgttgtgcacggca
gaggctttgtgcggcgatgttcgctgtctgcaggcgcttttgcgcagcgtgtctcagtcg
gcgtgggcgacgcctggactccaacatgtggtccaactccagctggctttgtttctcact
gacgcgctaacctcacataccactctcgcgcctgcgttgggtcagtccgcggacgacgta
cagctcctggcatcgcgggccatcacagccgatggcgatgcatccgcactcttgttcctc
ttgctacgtgtgctgtcgttccgccgtgcgcctgaagatgagttggatgtggacgaagta
gcacctgccgcgatggatgtcgagtttcaagaatatgtgcttcaacaagtggagcatctt
gttttgggtctcactacgacgtgttttccgctgcttcgcaagctgcagcgtgcagaagag
gacgcagcgatctcggtattgcgtgcatcctcacgccctgtcacaggagctggtgttagc
gctggtagcctgggaagcagtggaaccggtgcgggtggcgcgccacttgctcggcgctac
gacatcgaggcgttcttcgacctcgtggctcttttgtgccgagggcgaccagaatcggga
cttgctttctggcagggacctgaccgacgtatatctcgcttcctcctttgggctgtggat
actcgcgagctgggacagcaacgggcttttctgggcatgctagcgtcgctcgctgagggc
gagcagtgtgctgcctatgcgcacgcccttctcgaacatgatgcaggagctcctgccggc
agcgagcgccgtctcgtgacgtggacacgcctctttgagtggatggctcactacatagag
gcgttccagcggcacgctgtcgctgtcatgccaccggatgagttggtgttgttgcgtgcg
tttctcaacgtacttgctactgtcgtgcggtacagcgcagccacgcgcgatgctttgttc
tggcacaaggagtacatgccggtcgatcgcctgttctcgctatacgcatgtgccgtgcca
atggacttgaaagcagcaattcttcgtgctattggcgcgtttgctgtccaatctggcacc
agcacatctgcacgcattgtaaccgtgctgtgggagcgcctgaatctgagcggtgctgtc
cgcagcgttcgtggtgagccgccgcgtgccttgtacgagcttgagaacgtggaatgcgtg
catgggcgctttccaagcacgcatgccctcgtcgatctgctgagcgccattgtgccacat
gttgcgcctgcatctcaggctgacacgcttgtcgcctatatgcgtgacgcatcgcttccg
tggtggcattcaggacgcaactcaaccaccgcctccagcaccaccgcgagcaccagtcat
ggtagcggcaactccatgtccacttcaatgtatgtggcatacgtcctggaccatgtgctt
ctgccagcgtccaatcgcacctatgcacgaccggcagaacgttgggccatctctgcgtca
tgtttggaattcgccgaaaagtgccttgcgacgcttcctgttgcgcctgttgacacagcg
cacccaggctttgatgtgctgcggcgtctgttgagtggcacgcctctcttgcgggaactg
ttctttttcgtgcatccagatccctcgtgtgcagggtatgaagtcatcaatatgaaccgc
gcacaaacacccgacttttctcgagctgtacgagcagcattacggattctcctccgcatg
ctcgaggtccagaacgatgtgctccacaatgtcccctctatcaacgaccacgctgcagtg
aaggatcgtgcactcttcttggcgttggacgttcacctgttgcaagcgcaccaggtcgtt
gtacagatagcgctgtacatcctgtgtgtcgatacagagattgcttggcttgctgtgcgc
ttactcggcgctctcgctcggacatcaacgttccaagccacagatgcttttggaccgctt
cgcgcacgtacctcccgcaaccgtttggccggccttcttgacatggcaggtgagacagcg
cgcgtcacgagtggcgttcttgcatggcttgaggcggacactggcatggacgctgattct
gataatcttaactatgacgcggacgtgaatggaaactaccatgctcccggcacaacagcc
cacatggatatgagctcgtcgctcagcgacgcagatggagtcgccagtcttaacgataca
gccacaggcatcctgccggccaagattcagaaggagctcttagacctgtttctcgagcaa
ctcgtacctgacgcacctgcgcccaacgtcgcgcatctgcttcttggcttcgacatggac
gcaagcgatccggatcgtctcgtgcatgaatcgcgggacgccatcctccttactctagtg
cagcgagtaacaccaccctgtacgtggccgcccacgctggcggaacggtgctatgctgtg
cttcagcgagcatgtgtccacccgtacactagtgcgtccatgctgcgcttcctacgaacg
catgactttgtggcgacacagctgcggtcgctgccactggtgccattgtcggtcacgtcg
tcttcttcggcgactggcccttcgtttggcacactcatgtatgcttcaggcgagacggtt
agcacgcgcacggagtgggcgcttgccttgctccgcacacacgcacacatcctttcgctt
gtagctttggagctgcatactcttgctgcacatggccagctgcagcgtgctgtgccgctc
atgacgcttctcctgggcgagccggtgatgcacggcacaggcggtggcagtggccggtgg
cgccctttgctagaagcgacgcacgtgacctgggagaacgcagcggaggacagcgtttcg
gagccgaagtgggtagctgctcgtctcgccccagccctcgtccctgataccgcctctgcg
gcccgtgtatacgacatccacgaggtagctgcccttctcctggaagaacgtggcacgcag
gagcacacggtttggtttgagcaggcacgccgcatcttgctatgggccgctgcgcagaac
actcgtcgcgcattcgcttacgcacgcagggaagcatttattgcgtggcgacaagtcatg
gaagtcctcgttgggcaggcactcacaaccgttgttcgagccgacgttcgtgtgccgatc
ttgctagactgtgcgaatgcgctacttcctcggttgcaggaccaagacgatgcgttggtc
ccaagtattgcggccagtactatcctgtcgctcctgcatgctgtacgtgagcatgaggat
gtgccggctgaacgacttgtattgatcgtccgtgctattctggacgttttgagtttcggc
acacaggcaagtactcgctgcgacttgtacctgagtttggtttgtgcacaacaacttgtg
tgcagtcgctcctcagtcagccatggtggccgtgcagctgccgctcatcgcgtttactct
ctttttgcgacccatgccgctcatcttgtgaatgttctcgcacgcgatgcgctagatggc
tcggacgtagcacagaccgtatctctcacgacgctgagtcatcttgtggcctgggatggt
gcgtcgtccacggcatcgtccccatcgccagcaagcgcgtccgtgttgcctgcactgcac
attggtgagaagcttgcatcagctggcttcttgaagagtcttgccctccgtatccacgag
cttgatgtgccgctgcaagcaacactcacgcccgatccgccctcgctgaatgctctgtat
gtctatgaggcattactgagtgtattgggccgtctagcgcgaagcaaggcatctctgttg
ctagaagcgcgcatcgttgacgttctggcgcgcgttgactttccttcactgcggcctgag
cacacgcttgatgatatggatggattcctaccgcctgtggctgagcggtacgctagcttg
ctgatgccacttctccagctgcttgttacgctcctcatgtccgtgccgcaggcgcgcgag
agcgtgcatgctgttctggtcgctcaccaggatgctttcctggccgcactgcacgctgcc
actcattcgtctgccggcacaggcgatgttgagcaggcagccctgctcgtgcagatcctt
acattcatgacgcctccgctgctaccgacgccgccaccatttcatgctgcatgtcttgct
ttggccgcaacctacttggtgccgaatgcgcacgaggctctcaagccactgacactagcg
gagcgagaagacgcatccatctttgctccgacttataatggcttagtgcagacagcacca
gatgcgcgtctgaccttgtttgatgcatcggcacggcgtgttgtagaccgcctcgcacgt
gcactcgtgcagtacatggagctggcaagcagtcacggcgaggcacgcgccattcttgtg
ccgtcaatgcatgtcgctcgtgtgtcagaccatgcatcgtccgccgcgcgaattgttgct
gcgccgtccttaggcgttgcaatcgccgccctgggagagcagtgtgcatcagtcgcactt
gcactctcgagcttggatcgggtcaacgcgcttctccgtgatcccgagtccgtgcatgct
gacgagtggactgacatggcacaagatgcaggacttctgtcactctcagcttcttcagcc
cttacaatgcaatgccgtgcagcgtgtgaaaaagcactagactgtgtgtcgaaggatctc
actgcgacagtgttagcaaaactcgacatgatcgaacgctggcttgtgatgctcgtacgc
cacctagacctgtttatgcggatcggtggcgcctcgcgtgcctctttcgatgcagcagcc
ttgcgttcaagtgctaacgcagcgcttctcccgattctagacgaccaacttgcgtacttg
acggtgccgtcccatcttgtgccttctgctgatgaacacgtcacattccttcatatcagt
gcgcgtcgtgtagccgagcgtctcttagaaacatcacctttgtaa

DBGET integrated database retrieval system