KEGG   Malassezia globosa: MGL_3385Help
Entry
MGL_3385          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mgl  Malassezia globosa
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mgl00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MESYLVDERNTSMAAVRTACSITTKVFKTLTTAESVTKKDKSPVTIGDFSAQATINYILN
KKFPHDGIVAEETSSDLQGEAGKTNRDKVCALVNEALQASGEIQAPLSDDDILATIDKGA
FQGGRQSRFWTLDPIDGTKGFLRGGQYAVCLALIVDGNVELGVMGCPNLPCDKSKPKPAD
GEIRTSSMEGLGVMFVALRGHGAYSVPIDDVHAPLVPVCMRDLQGDIRQATFCESVDAGH
SSLGTNARIAELLGMGDRHVRMDSQAKYGSISRGDGDVYLRLPVGDGSYQEKIWDHASGS
LLVEEAGGKVTDIAARPLNFGLGRLLSANKGVVACQANMHAKVIDAVAQALEEEGRASLL
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttacctcgttgatgagcggaacacgtcaatggcggccgtgcgtacggcatgc
tccatcacgacaaaagtgtttaaaacacttacgactgccgaatctgtcacaaagaaagac
aagtctccagtaactatcggcgactttagtgcacaagcaacgatcaactacattttaaat
aagaagttcccgcacgacggcatcgtcgctgaagagacctcgtccgatcttcagggagag
gccgggaagacgaacagagacaaagtgtgtgcactagtgaacgaagctctgcaggcatca
ggggaaattcaagcccccttatctgatgatgatattcttgcaacaatagacaagggcgca
tttcagggtggacgccagtcacgtttctggacacttgatcccatcgacgggaccaaaggc
tttttgcgcggtggacaatatgctgtatgtcttgcacttattgtcgatggaaatgttgag
ctgggtgtgatgggatgtccgaacctgccttgtgacaagagcaagccgaagcctgccgat
ggtgaaatacgcacatcgtccatggaaggtcttggtgtaatgttcgttgccttgcgaggg
catggcgcatattctgtgcctattgatgatgttcatgcaccactagtgcctgtctgtatg
cgagacttgcaaggcgatatccggcaagcgacgttctgtgagtcagtagacgcgggacat
tcgtctcttggcacaaatgcacgcattgccgagttactaggtatgggcgatcggcacgtg
cgtatggacagtcaggccaagtatggaagtatctcaaggggtgatggagatgtctactta
cgtctgcctgtcggagatggcagctaccaagaaaaaatctgggaccatgcttcgggttcc
ctgcttgttgaagaagccggcggtaaagtcacggacattgcagcacgacccttgaacttt
ggtcttggccgtttgctgtccgccaataagggtgtggtggcgtgtcaagctaatatgcac
gccaaggtcattgatgctgtggcccaggcacttgaggaagagggccgtgcgtcgctactg
aaatag

DBGET integrated database retrieval system