KEGG   Malassezia globosa: MGL_3387Help
Entry
MGL_3387          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
mgl  Malassezia globosa
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1757 aa AA seqDB search
MTDPEHAPGPLTMENVKRLEREQEAAASEAWDANVNANANANVSSVTMDTADMLGEGPRH
GALLQAEAEDWVLLESPYMTHWNNKRHNTNGIPRARRASDMPDWRMRERLRTVTAALVMC
LNIGVDPPDVSKTNPCSKLICWMDPESLDASKALPAIGRNLQVQFETLSMKTRYKQYLDP
IVEETKRFCTNLRRTAKDERVLFYYNGYGVPKPTPGGEIWVFNKAYTQYIPLTLYDLQTW
LGQPCIYVWDTSAAGHIVANFRRLAEARAEDEIKAALAEGREPPPMPSPDGITIDATGEP
QFPLRDSIHLAACGADEVLPMNPDLPADLFTCCLTSPIEISLRWFVLQNPLPSPLNVDMV
MNIPGRLQDRRTPLGELNWTLTAVTDTIAWTVLPRALFRRFFRDDLMVAALLRNYLLAER
IMRFYHCTPVSHPRLPPTHNHPLWDSWDLAVDQCLSQLPTLLAKEQARADAENLGIPMPP
HLASFEYRHSTFFSEQLKAFEVWLSQGDVSRHPPRRRVQRHPVVRVNGSSMSDVSTSLSA
TSSLAAKAVASAAASATGTTTVAPSSAVPDLASSTSGLGVVSMHRRQSAGPGSMTGVASG
TVEDSDSDTDSVADDPDAKATLSREHDPPSQLPIVLQVLLSQVHRLRALILLSQFLDLGP
WAVNLALSIGIFPYVLKLLQSPAADLKPVLIYIWARILAVDHSCQVDLLRDNGYLYFAAV
LSPFQPGQMPGHGVAAVPTTAVPSTAAPAVATDAHPMAHAHGGAAAGSVPNVGGAGAGQT
LPIPNVSEHRAMCAFILAVFCQDFSLGQDACLETDVMDACLEHLEDDDYLLRQWSALCLA
QLWDNNDVGKARAIAKDAHGKLCCLLSDASPEVRAAILYALGVLLGTSGGALCDASDGAT
SSDRRRERARGAGRPPCICTGALTGLTPARQRNMEVGIAMAILASGSDCSPLVRKELVIA
LSALVHHYHGFFVLAAYLCYMRDTAVYGEETPTQHAAAAPADMNADIEERLTQEERLLTG
IVRGIIQHGESVETSDIANVPAFVTLFVALLDLSVDAHPEVANLASTVVDQIMAALVEHG
ALYADNSTMRQKSLEQLSQPHIMPTAAEPLSAAANHTSSLAGAAGALGATATKSRGSVSS
LPSGMNTRASASASANASATDSRARPNAASHGVGVGAGVGSGAGYAAAPPAAATVGLPGY
PSDRGFVDPSGDEPAGRGSTIARTIRAISSIAGTPAPSHAPAKVAPVLTSVAAPTRAAAA
SADGTPIATYKAPYGGGSQQPVCMTSQDSFSAGMPTARSRREVHIEDALAECIAADLHRL
SVRGRDDTPPTTWLGRVQEQLPLKSRLFEWCSEYYTEPQMKSAEADEPGSSQYNRQMWRR
QRCEQHMAEAMEQVGDAGSVRWSERVGMLTMPSAVQMLCFHEYDPHVVSVTDQDTLCVWD
WQEQRLLSSFCNGHRPHGPVTSLAFINEEVDALLLTGAADGHVHIYRQYARGCGSKHGPE
LVSAFRVLPDLLRSRYPSGVRVTWQQVSGRLLAGGDSRLVRLWDAHRELCISDVPTHVNS
CATSLTSDTDIGHLFMAGFGDGSIGVYDQRNPPTSSLVQLWEEHNAWVQTVHLQRHGARE
LVSASVDGQVRVWDIRARSSVLQCSAAWDHASTLSDMAVHDRIPVLAATSSPRPGGSSHI
HTTQMYSLADLSPLGRPYQRPLQAPSLLSSGPARSLRDRFTPPSRYSPSTSIVAFHPHHP
VLAFGGPDHLVEIFRYV
NT seq 5274 nt NT seq  +upstreamnt  +downstreamnt
atgacggacccggagcatgcgccgggaccgttgaccatggaaaacgtgaaaaggttagag
agggagcaagaggcagcggcgtcagaggcgtgggacgccaacgtgaatgccaacgcgaac
gccaatgtgtcaagtgtgactatggacacggctgacatgcttggcgaaggcccgcgccat
ggagctttgcttcaggctgaagctgaggattgggtgttgcttgagtctccgtacatgacg
cattggaataataagcgacacaatacgaatgggattccgcgtgcacgacgagcatcagat
atgccggactggcgcatgcgtgagcggttgcggacggtgacggcggcgctggtgatgtgc
ctaaacattggtgtggatccgccggatgtaagcaagacaaacccatgctcaaagctcatc
tgctggatggatcccgagtctctggacgcgtcgaaagcgctcccggcgataggacgcaac
ttgcaggtccagttcgagacgctgagtatgaagacgcgctacaagcagtatttggatccg
attgttgaagagacgaagcgcttttgtacgaatttgcggcgtactgcgaaggacgagcga
gtgctgttttactataatggctacggggtgccgaagccgacgccaggcggcgagatctgg
gtgtttaacaaggcgtacacgcagtatattcctctgacgctgtacgacttgcagacatgg
ctcgggcagccgtgcatctatgtgtgggatacaagcgccgcgggccacattgtcgcgaac
ttccggcgtcttgcagaagctcgtgcagaagatgaaatcaaggcggcgttggccgaagga
cgtgagccgccgccgatgcctagtccagatggtatcacgattgatgcgacaggagagccg
cagttcccactgcgtgattcgatccatctcgcggcatgcggcgcagacgaagtgctgccg
atgaatccggatctccctgcggacctatttacttgttgcctaacatcgccgattgagatc
tctcttcgctggttcgtgctgcagaatccgctgccgagtccactgaatgtcgacatggtg
atgaatatcccaggccggctccaggaccggcgcacgccgttgggcgagctaaactggaca
ctcactgcggtcactgacaccatcgcttggactgtgcttccacgagcgctctttcgtcgc
ttcttccgcgacgatctcatggtcgctgcgctcctgcgcaactacttgctggcagaacga
atcatgcggttctaccactgcacgcctgtgagtcatccgcgactgcctccgacgcacaat
cacccgctatgggacagctgggaccttgctgttgaccagtgtctttcgcagttgccgact
ctgctggccaaggagcaagcacgcgcggatgccgagaatctcggcatccctatgccgccg
catctcgcctcgttcgaataccggcactcgacgttcttcagcgagcagttgaaagcattt
gaagtgtggctttcgcagggcgatgtgagccggcatccgccgcgtcgacgagtgcagcgg
catccggtcgtgcgggtgaatggcagctccatgtcagacgtgtcaacatcgttgtcggcg
acgtcgtcactagcagccaaagccgtagcctcagcagcggcctcggccacgggaacgacc
acagtggctccgtcgtccgcggtcccggacttggcgtcgtcgacctctgggctgggagtg
gtatcgatgcatcgacgtcagagcgctggccctggctccatgacgggtgtagcttccggc
acggttgaggactcagactcggacaccgattcggtcgccgacgatcctgacgcgaaggcg
accctgagccgtgaacacgatcccccatcgcaactacccatcgttctccaggttcttctg
tcgcaggtgcatcgcttgcgagccctgattcttctgagccagttcttggacctggggccc
tgggctgtcaacctggccctgagtattgggattttcccgtatgtgctcaagcttctgcag
agtccagctgctgatctcaagccagtactgatctatatctgggcaaggatcctggctgtc
gatcatagctgtcaagtcgacctgctccgtgataatggctacctgtactttgcagcggtt
ttaagcccgttccagccagggcagatgccaggccacggtgtagcagcggtaccaacgact
gccgtccccagcactgccgcacccgcggtggcgaccgatgcccatcccatggcacatgcg
cacggtggtgcggccgctggctctgtacccaatgtgggtggagcaggcgcagggcagacg
ctgccgattccgaatgtaagtgagcaccgggcaatgtgcgcgtttattctcgctgtcttt
tgccaggacttttcactgggtcaggatgcatgtctcgaaactgacgtgatggacgcctgc
cttgagcatttggaggatgacgattatttactccgccagtggtctgcactgtgcctggct
cagctctgggacaacaatgacgtgggaaaggcacgtgcgattgccaaagatgcgcatggt
aagctatgctgcctgctgagcgatgcgtctcctgaagttcgtgcggccattctgtatgcg
ctgggtgtgctgctcggcacaagtggcggtgccttgtgtgatgcatcggatggggcgacg
tcgagcgataggcggcgtgagcgggcgcgtggcgccggccgaccgccgtgcatatgtacg
ggggcactgacaggtcttacgcccgcgcggcagcggaacatggaagttggcatcgcgatg
gccatccttgcctcaggaagcgactgcagtccgttggtgcgcaaggagctggtcattgct
ctgagtgcgctcgtgcaccactaccatgggttctttgtgcttgcagcgtacctatgctat
atgcgcgatacggctgtgtacggtgaagaaacaccgacgcagcacgcagctgctgcgccg
gctgatatgaatgcagatatcgaggagcgcctcacacaggaagagcggcttcttaccggc
attgtgaggggcatcatccagcatggtgagtccgttgagacgagtgatatcgcgaatgtg
cctgcatttgtcactttgtttgtggctctgctggacctgagtgtcgatgcgcatccggaa
gtggctaatctggccagcactgtcgttgaccagatcatggcggctctcgtggagcatggc
gcgttatatgcggacaattcgaccatgcgtcaaaagagtcttgagcaactatctcagccc
cacatcatgccgacggccgcagagcccctgtctgctgctgcgaaccatactagctcgctc
gcaggtgccgcgggggccttgggcgctactgcgacaaagtctcgtgggtctgtctcctcg
ctccctagtggtatgaatacccgggccagtgccagtgccagtgccaatgccagtgccact
gacagtcgagcgcgtccaaatgccgcctcgcatggtgttggggtaggagcgggtgtagga
tcaggagcaggctatgccgcagctccacctgcagccgccacggtaggactgccgggctat
ccatcggaccgtggctttgtcgacccaagtggtgacgaacctgcagggcgcggctcgacg
attgcgcgtacgatccgggcaatctcatccattgcggggacacccgctccctcgcatgcg
ccggccaaagtggcgcctgtcttgacgagtgtcgcggcacctacgcgagcggcagcggcc
tcggctgatggtacacccatcgcgacgtacaaggcgccctacggcggtggcagtcagcag
cctgtgtgcatgacaagccaggattcatttagtgcgggcatgccgacagcacgttcgcga
cgcgaagtccacattgaagatgcgttagccgagtgcattgccgctgatttacaccgtctc
agtgtgcgtggtcgcgacgacacgccgcccaccacctggcttggccgtgtgcaggagcag
ctgccgctcaagagtcgcctgttcgagtggtgcagcgagtactacacagagccgcagatg
aagtctgccgaggccgatgagccaggcagctcgcagtacaaccggcagatgtggcgcagg
caacggtgtgagcagcacatggccgaggcgatggagcaggtcggcgatgcgggctcggtg
cgatggagcgaacgcgtgggcatgctcactatgccatcggctgtgcagatgctgtgcttc
cacgagtacgatccacatgtcgtgagtgtgacggaccaggacacactatgtgtgtgggac
tggcaggaacagcgcctcctttcgtcgttctgcaatggccaccggccacacgggcctgtc
acgtcgctcgcgttcatcaacgaagaagtggatgcgttgctcctgaccggtgctgcggat
gggcacgtccacatctaccggcaatatgcgcgtggctgcggctccaaacacgggcccgag
cttgtgagtgcattccgtgtgctgccggatctccttcgcagtcgctaccccagtggtgtg
agagtcacatggcagcaggtcagcggccgtctgctggcaggcggtgacagtcgtcttgtg
cgactatgggacgctcatcgcgagctttgtatatcggatgtgccgacacacgtaaactcg
tgtgccacgtcgctgacgagcgacaccgacataggccatctgttcatggccggctttggc
gacggctccatcggcgtatacgaccagcgcaatccacccacatccagccttgtgcagctg
tgggaagaacacaatgcgtgggtgcagactgtgcatctgcaaaggcatggcgctcgcgag
cttgtgtcagccagtgttgatggccaggtccgcgtgtgggacatccgagcgagatcatct
gtgctccagtgctcagctgcttgggaccacgcgtctacgctttctgacatggccgtgcac
gaccgcattcccgtgctcgctgccacgagctcgccgcgtcctggcggctcgtcgcatatc
cacactacccagatgtacagcctcgctgacctctcgcccttgggacgcccgtatcagcgt
cctttgcaggctccctcgctactctcgagtggtcctgctcggtctctgcgcgatcgattc
actccgccatcgcgctactcgcccagcacgagcatcgtcgctttccatccacaccatcct
gtcctggcgtttggtggacctgatcatctagtggagatcttccgctacgtatag

DBGET integrated database retrieval system