KEGG   Malassezia globosa: MGL_3414Help
Entry
MGL_3414          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
mgl  Malassezia globosa
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGL_3414
Translation factors [BR:mgl03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MGL_3414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 759 aa AA seqDB search
MADASTSTSTAQQQQQQHRMDPTSSVEDIDFSDIEAKYEVHMDEGLDNDIVINGVPIVTS
AKEQRLFEAIQKRFRTQANIDVSLDAMHIPYKEDGESKGYIIMELANNEEATQAIRAMNG
YAFDKRHRFVLNRLTDVERLANMDEAYKDPEEEPFHQRGHLRSWLMDQAGRDQVVMCARD
DVLVSWHSRTAQPDEAHKRTRWTESYVQWSPLGTYLATFHMQGIALWGGPTWERIMRYPH
PGVRLVDFSPNEKYMVTWSPEPIQVSDNAPQGPQFFAPEDEGNRVAVWDVRTGHLLRTFP
ILQEDTTGPTGPAIKGFSWPFLKWSGDSKYCAKVTPGKGISVYQLPSMGLLDQKSIKIEG
VVDFEWCPLGDKDKDALEIWNDGKNKDLPKGFKKPRDNMLVYWQPEVQNQPARVTVISVP
KREILRSKNLFNVADCKLHWHPQGDFLCVKVDRQTKTKKTVFCNFELFRMREKDFPVEVV
ELKDPVVAFAWEPQGTHFAVISSNDPNLGVVAPSITLKTQLHFYHLHPRGDFRLLKTLDN
KTCNALFWSPRGRHLLTATLGSSSKFDLEWYDVDFNNDARQNSSGEVLEEVKLIGSGEHY
SITDVEWDPSGRFVTTSSSLWRHSMEQGYAIWDFRGNELQKNIIEQFKQILWRPRPRSLL
SKDEMKRVRRNLKEFSKVFDQEDQEAESSQALAHREEYKRMLEEWKSWRAYNREALQKAQ
EEGKEPTAISSASQLEKESTEEIQEWVEEVLEEKEEVVG
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcctcgacctcgacgtccaccgcgcagcagcaacagcagcagcacaggatg
gatcctacatcttcggttgaagatattgatttctcggatatcgaggcaaaatatgaagtg
cacatggatgaggggctggacaatgacattgtaatcaacggcgtaccaattgtgacgtct
gctaaggagcagcgtctgtttgaggcaatccagaaacgattccgcacacaggccaacatt
gatgtgagcctggatgcgatgcacatcccatacaaagaggatggcgagtcaaaaggctat
attatcatggaactcgccaacaatgaagaggcgacgcaagcgatccgtgctatgaatgga
tatgcgtttgacaagaggcaccgcttcgtgctgaaccgtcttacagatgtagaacgtctt
gcaaacatggacgaagcgtacaaggaccctgaagaggagccattccaccagcgtggacat
cttcgttcatggctgatggaccaggccggacgcgatcaggtcgtgatgtgtgcgcgcgac
gatgtgcttgtgtcgtggcacagccggactgcccagcccgatgaagctcacaaacgcacg
cgctggactgagtcgtatgtgcaatggtcgccacttggtacatacttggctacatttcat
atgcagggtatcgctctgtggggcggcccaacgtgggaacgaatcatgcgatacccacac
cctggtgtgcgtcttgttgattttagtccgaatgagaagtacatggtgacatggtcgccg
gaaccgatacaagtgtccgataatgcgccgcaaggaccccagttctttgcgccagaagac
gagggcaatcgtgtcgctgtgtgggacgtaagaacaggtcaccttttgcgcacgttccca
atcttacaagaggacacgacaggacccacaggtcccgcgatcaagggctttagctggcca
ttcctgaaatggagtggggacagcaagtactgtgcaaaggtgacaccaggcaaaggcata
agcgtgtatcaattgccatcgatgggtctacttgaccagaagagtatcaagattgaaggc
gtggtcgattttgagtggtgcccgctcggcgacaaggataaggacgcgttagaaatctgg
aatgacggcaagaacaaagacctgcctaagggcttcaaaaagcctcgcgacaatatgctt
gtgtactggcaaccagaagtccaaaaccagcctgcgcgtgtgactgtgatcagtgtgccg
aagcgagagatcttacgctcaaagaacttgtttaatgtcgcagactgcaagttgcattgg
cacccacaaggagactttttgtgcgtcaaagtcgaccgacagacgaagacgaaaaaaact
gtgttttgcaactttgagcttttccgcatgagggaaaaggacttcccggtcgaagttgtc
gagctgaaggaccctgtggtggcatttgcgtgggaaccacaaggcacgcatttcgctgta
atctccagcaacgacccgaatctaggtgttgtggcccctagtatcaccctcaagacgcag
ttacacttctaccatctacaccctcgtggcgatttccggctcctgaaaacactggacaac
aagacctgcaatgcgttgttctggtcgccacgtggtcgtcacttgctcacagcaacgctc
ggctcgtcgagcaaatttgatctcgaatggtacgacgttgactttaacaacgatgcgcga
cagaactcgtcaggcgaagtgctggaggaagtgaagctgattggatctggcgagcactat
agcatcacggatgtggaatgggaccctagtggccgttttgtaactacttcctccagcctt
tggcgccactcaatggaacaaggctatgcgatctgggacttccgtggtaacgaactgcaa
aagaatatcattgagcaattcaagcaaattctgtggcggccccgcccacgatctttgctt
agcaaggacgagatgaaacgcgtgcgcaggaacctcaaagaattctcgaaagtattcgac
caggaagaccaagaggccgagagcagccaggctcttgcgcaccgcgaagagtacaagcgc
atgctcgaagaatggaagagttggcgtgcatacaaccgcgaggcgctccagaaggctcaa
gaagagggcaaagagccgacagctatatccagtgcctcgcagcttgagaaggagagcaca
gaggaaatccaggagtgggtcgaggaggtattggaggagaaagaggaagtcgtcgggtag

DBGET integrated database retrieval system