KEGG   Malassezia globosa: MGL_3419Help
Entry
MGL_3419          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mgl  Malassezia globosa
Pathway
mgl00630  Glyoxylate and dicarboxylate metabolism
mgl01100  Metabolic pathways
mgl01110  Biosynthesis of secondary metabolites
mgl01200  Carbon metabolism
Module
mgl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MGL_3419
Enzymes [BR:mgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MGL_3419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase Arg_repressor_C
Motif
Other DBs
NCBI-GeneID: 5853691
NCBI-ProteinID: XP_001729384
UniProt: A8Q962
AA seq 298 aa AA seqDB search
MPYDPKNEDALFQKEVEDVKQWWKSPRFVGVTRPYTAEAVVSKRGTMRQHYLSNEQAKKM
WGLLEHHAKNKTTSHTFGALDPVQVSQMAKYLETVYVSGWQSSSTASSTNEPGPDLADYP
SNTVPNKVEHLFMAQLFHDRKQQDARRSMTAEQRAKTPYVDYMRPIVADADTGHGGLTAV
MKLAKMFVEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLIAIRLQYDIMGVENL
VVARTDSEAATLITTNVDERDHPFILGTTNRDLQPLVEVMTAAERSGKQGRRPSCGRG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccatacgaccccaaaaacgaagacgctctattccaaaaagaagtggaagatgtaaag
cagtggtggaagtcgccgcgcttcgtgggcgtgacgcgtccatatacagccgaagctgtg
gtcagcaagcgtggcacaatgcgccagcactacttgtcgaacgagcaggctaagaaaatg
tggggcctgctggagcatcatgcgaagaacaagacgacatcacacacatttggcgcattg
gaccctgttcaagtgtcgcagatggccaagtaccttgagactgtgtatgtgtcagggtgg
cagagctctagcacagccagctcgacgaacgagcctggtcccgacctggctgactaccca
tcgaatacggtgcccaataaggttgagcacttgtttatggcacagcttttccacgatcgc
aagcagcaggatgcccgtcgcagtatgaccgccgagcagcgtgcaaagacgccctacgtg
gactacatgcggcccattgtggctgatgctgacacaggccatggtggtcttacagccgtt
atgaagttggcgaaaatgttcgtcgagaagggtgctgctggtattcacattgaggatcag
gcgcccggtacgaagaagtgcgggcacatggccggaaaagtactcgtgcccatctccgag
catatcaaccgtttgattgctatccgtcttcagtacgacatcatgggtgtggagaacctt
gtcgtggcccgcaccgactcggaggctgcgacgcttatcaccaccaacgttgacgagcgg
gatcatccattcatcctcggcacgacgaaccgtgacctgcagccactcgtagaagtgatg
accgctgctgagcgcagtggtaagcaggggcgacgcccttcatgcggtagaggatga

DBGET integrated database retrieval system