KEGG   Malassezia globosa: MGL_3516Help
Entry
MGL_3516          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mgl  Malassezia globosa
Brite
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MGL_3516
Peptidases [BR:mgl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGL_3516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1232 aa AA seqDB search
MTRSSSPTNTPTHTSCLDTLEEGEGALPTSVLDRFKRARTTSPDTDIGSARSVTPDAEYK
SGTAVPTRATDKDDMPGSSAMRSSDECVNALMDESLSLDDARVPHTTLVREVETWRASQP
RIGDTWYVIPADWYERWKVKPQGIAAMNLEALCTNDNGNVTARYRPLRQDLVEHADYELV
PAQAWDILASRYRIHGPALGRSVVPGQAPGQARIELFPPCIELAVCGESPEVEPFRSAAA
SIASSTSLLPTVRLSSGVSLRTLKAHVRAMHLCPRHEDAHVRFFRLPPSLKLTALTEHGM
LSKQALAKADPPIELVEGTDDATLASLDLTAPSVFLGIDVRVRTASDPRSFTWQVSTTTS
DTGTTDALPTSHTSSRTAITPAPAFLPSLAPPAQHGSTARPCGLRGLANLGNTCFMNSAL
QCLSNTHELQQYFLNGVQMDELNTDNPLGMGGTLAMAYGRLVSALWSESASGAVVPREFK
TTLARFAPQFMGYAQQDSQELLAFLLDGLHEDLNRIHKKPYIEAPDWIGGSDADMVRFAQ
QQWDLYKARNDSVIVDLFQGQYRSTLVCPTCHKVSVKFDPFMYLTLPIPNTRKWRGRVYV
VPQHAAQPLVQVDVQLPATATVAELRTKVADLLSMDPACLLMGEVWSYHVYRWLEAFEPV
SDISASDYIYLWEVADAFTMPKPMKPTTSRFSFFSRPERTVADIEAAYPPPSDMPATICL
PVYSCKADGPDRFGSFRRSLGEPFGLPFFVSIPREKAHDVAWIYAQVLEQYVRFSPEASA
TDLCAKAADAKRATDARTSADPSTSPDAVPPHTSASVVECAAPPAFPFALRFSVPSADEA
MHRGDDANDQTTECMTQRAARLGCPPNSDEASHAAWPVTYPGGALYALWEGAVADAVLEQ
VRANQTWGPISLAQDADFQKGTAMLAEGKRRAPKLRLDDCLDEFTRAEQLGENDLWYCPA
CRDFRQATKKFDLWKVPDILVVHLKRFSAGRGTRDKLDNWIEFPLEHLDLRDRVVGTRLW
HSLRMERAPSQMQLKEGLIVSHDTHDDDVLADEPVYDLYAVDNHFGGLGGGHYTAFAKNP
ADGHWYNFDDSCVRPVSDPDMVKSSAAYLLFYRRRTTRPIGSTSRDRLMEKQQQQALATA
STAASCTDTASPGRTGPPGSPAPVAPPFLPAATSPSLPVSSAPWPPSPTMSSSSSSSTSS
PTSPISSSTDTKVPLNTDETHVAPDLDDDPSL
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgacccgatcttcctcgccaacgaacacaccaacacacacgtcttgtttagacacgctc
gaagaaggggaaggtgcactacccacttctgtactagatcgattcaaacgcgctcgtacg
accagccccgacacagacatcggatccgcccgcagcgtcacgcctgacgctgagtataag
agtgggacagctgtaccgacgagagccactgataaagacgatatgcctggctcaagcgca
atgcgctcgagtgatgagtgtgtgaatgctctcatggacgagtctctcagtctcgacgat
gcacgcgtgcctcataccacgctcgtccgtgaagttgaaacgtggcgcgcttcgcagccg
cgcatcggcgacacttggtatgtgattccagccgattggtacgagcgctggaaagtcaag
ccgcaagggatcgcagcgatgaacctcgaagctctttgcaccaacgataacggcaacgtg
acggctcgataccgtccattgcgtcaggatctcgttgagcacgccgactatgagcttgtt
ccagcacaggcgtgggacattctcgcgtcccgatacagaatccatggccctgcactgggc
cgctccgtcgtgcctggtcaagcgcctggtcaagcgcgcattgaattgtttccgccttgc
atcgagcttgctgtgtgtggcgagtcgccagaggtagagccattcagatcagcggctgca
tccatcgcatcgtcgacgtccctgttgccgacggtccggttatccagtggtgtctccctt
cgcacactaaaagcacatgtgcgtgctatgcacttgtgtccgcgacatgaagacgcacat
gtgcggttcttccgcttgccgccgtcgctgaagctgacggctctcacggagcatggcatg
ctctctaagcaagcgctggcaaaggccgatccccccattgagcttgtcgagggcaccgac
gatgcgacgctagcgtcgctggatctcacggcgccgtctgtgtttctaggcatcgacgtg
cgtgtgcgcacagcgagtgacccacgctcgttcacgtggcaggtcagcacaacaacgagc
gacactggcaccacagacgcattgcccaccagccatacatcgtcacggactgccattacg
cccgcgccggcgtttctgccgtcattagcgccgccggctcagcacgggtctaccgcgagg
ccatgcggactgcgtggcttggcgaacctcggcaacacctgcttcatgaacagcgcatta
cagtgcctaagcaacacccacgagctccagcagtacttcctgaacggtgtgcagatggac
gagctcaacaccgacaacccattgggtatgggcggcacactcgcaatggcatacggccgt
ctcgtcagtgctctctggagcgagagcgcatcaggcgctgtggttccgcgcgagttcaag
acgacactcgcacgctttgcgccgcagttcatgggatatgcccagcaagacagtcaggaa
ctgttggcattcttgctggatggactgcatgaagacctgaaccgtatccacaaaaaaccg
tacattgaagcgcccgattggatcggcggctccgacgcggacatggtgcgctttgcgcag
cagcagtgggatctgtacaaagcgcgcaatgactcggtgattgtcgacctgttccagggc
cagtatcgcagcacgctcgtgtgccccacatgccacaaagtgtcggtcaagttcgatccg
ttcatgtatctaacgctgccgattcccaacacgcgcaagtggcgcggccgtgtgtacgtt
gtgccgcagcatgcagcgcagccgctcgtccaagtcgacgtccagctgcctgcgacagcg
acggtcgcagaactccgcaccaaagtggccgacctgttgagcatggatcctgcatgcctc
ctgatgggcgaggtatggtcgtatcatgtctaccgttggcttgaggcctttgagcccgtg
agcgatatcagtgccagcgactacatctacctgtgggaagtggccgacgcctttaccatg
ccgaagccgatgaagcccacgacgtccaggttctcgttcttttctcgtcctgagcgcaca
gtcgccgacatcgaggccgcgtatccgccaccgtccgacatgcctgcaaccatctgcctg
cctgtgtactcgtgcaaagcggacggccccgaccgcttcggctcgttccgccgctccctt
ggcgagccttttggcctcccgttctttgtgtctattcctcgtgagaaagctcacgatgtc
gcgtggatctatgcccaggtcctcgagcagtacgtgcgcttcagtcccgaggcctccgcc
acggacttgtgtgccaaggcagccgacgccaagcgcgcgaccgacgcccggacaagcgcc
gatcctagcaccagcccggatgctgtgccgccgcacacctcggcctccgtggtagaatgc
gccgcaccgcccgcgttccctttcgctttgcgtttcagtgtgccaagtgccgacgaagcc
atgcaccgtggcgacgatgcgaacgaccagacaacagagtgcatgacgcagcgtgctgct
cgtcttggatgtccaccgaacagcgacgaggcgtcgcatgccgcatggcccgtcacatac
ccgggcggtgcattgtatgcgctgtgggaaggcgccgtcgccgacgcggtgctggagcag
gtgcgtgcgaatcaaacatggggtccgatctcgctcgcacaagacgccgactttcaaaag
ggcaccgccatgcttgctgaaggcaagcggcgcgcgccgaaattgcgcctcgacgactgt
ttggacgagtttactcgggcagaacagctgggcgaaaacgatctgtggtattgccctgcg
tgccgcgactttcgacaagccacgaaaaaattcgacctgtggaaagtgcccgatattctt
gtcgtgcacctgaaacgcttcagcgccgggcgtgggacgcgcgacaagctcgacaactgg
atcgagttccccttagagcacttggatttacgcgatcgcgtcgtcggcacacggctgtgg
cacagtttgcgcatggagcgtgcgcccagtcagatgcagctgaaagagggtctgatcgtt
tctcacgacacacatgacgatgatgtgttggcggacgagcctgtgtatgatttgtatgcc
gtcgacaaccattttggcggcttaggtggcggtcactatacggcctttgccaagaatcca
gccgatggccactggtacaatttcgacgactcgtgcgttcgtcctgtgtcagatcctgac
atggtcaagtcgtccgctgcatatttgctattctaccgtcgccgcacgacacgtcctatc
ggtagcacgtcgcgtgacaggctcatggagaagcagcagcagcaggcccttgccacggct
tcgacggctgcttcgtgtaccgatactgcctcgcctgggcgaactggaccgcctggatcg
ccagcgccggttgcgcctccttttctccctgcagctacgtccccttcccttcctgtatct
tctgcgccatggccgccatccccgacgatgtcgtcatcgtcgtcttcctccacatcttct
cccacctcgccgatcagctcctcgaccgatacaaaagtgcctctcaacacggacgagacc
catgtcgcccctgatctagatgatgacccatctctgtag

DBGET integrated database retrieval system