KEGG   Malassezia globosa: MGL_3561Help
Entry
MGL_3561          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mgl  Malassezia globosa
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mgl01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mgl00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:mgl00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 704 aa AA seqDB search
MSRSRSRVEEHFVGAVSPEHAQSSETGRRVGDFVRAAGGHSVITKVLICNNGIAAVKEIR
SVRKWAYDMFGDERAIQFTVMATPDDLRINADYIRMADKYVEVPGGPNANNYANVELIVD
IAERAGVHAVWAGWGHASENPRLPEMLARLEPRILFLGPPGTAMRALGDKISSTIVAQHA
DVPCLPWSGTGITETIQSTEGYVSVPDDAYERACVHSAEEGLAIAQRIGFPVMIKASEGG
GGKGIRKCVSPDMFVQLYQAAVGEVPGSPVFVMKLASAARHLEVQVLADQYGQAISLFGR
DCSVQRRHQKIIEEAPVSIAPAETRLRMEQAAVRLAKLVGYVSAGTVEWLYSPETDTFAF
LELNPRLQVEHPTTEMVTGVNIPAAQLQIAMGIPLQHIDDVRELYGLGRVDERGQRCGAP
SARTSIDFDARHQSVDTSPKPRGHVIACRITAENPDTGFKPGIGSLSELNFRSSPSTWGY
FSVSTSGALHEYADSQFGHVFSYGADREEARKNMVFALKELSIRSDFHTTTEYLVMLLEQ
DVFVQNQVTTAWLDGLIENSVTARRPPTELAVLCGAAVKAHALAKESRDEFKRILHRGQV
PPRNTVRTKFSVEFIYGNVKYQFVAKQSAPTSWTLHLQQQQQQVHVSLRDLSDGGLLIGL
SGASHTVYWFDEVGQTRLVIDGQTCRMEEERDPTQICSPSPGKL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcacgttcaagagtcgaggagcatttcgttggcgctgtatcgccggagcat
gcacagtcgtcggagacagggagacgggtgggcgactttgtgcgtgctgcgggagggcac
agtgtgatcacgaaggtgcttatatgcaacaatgggattgcggccgtgaaagagatccgc
tctgtgcggaaatgggcgtatgatatgtttggtgatgagcgggcgatccagtttacagtg
atggcgacgcccgatgacttgcggatcaatgctgactacatccgcatggccgacaagtat
gtcgaggtccctggtggaccgaatgcgaataactatgcaaatgtcgagttgattgtggat
atagcggaacgagcaggcgtgcatgccgtgtgggcaggctgggggcatgcgtcggagaat
ccgcggctgcccgagatgctagcgcgtctggagccacggatcctgttcctggggccgccg
ggcacggcgatgcgtgcgctgggcgacaagatttcgtcgacgattgtggcgcagcacgca
gacgtgccatgcctgccatggtctggcacaggcatcacggagacgatacaaagcacggag
ggatatgtgagcgtgccggacgatgcgtacgagcgagcgtgtgtgcactcggcagaagag
gggctggcgattgcgcagcgcataggctttcccgtgatgatcaaggcatcggaaggaggc
ggtggcaagggcatccggaaatgcgtgtcgccggacatgttcgtgcagctgtaccaagcg
gctgtgggcgaggtgccggggtcgccggtgtttgtgatgaagctcgcgagcgcagcgcgg
cacctggaggtgcaggtgctggcggaccagtacggccaggcgatcagtttgttcgggcgc
gactgctcggtgcagcggcggcaccaaaagatcattgaggaggcgcccgtgagcatagcg
ccggcagagacgcgcctgcgtatggagcaagcggctgtgcggctcgcgaagctcgttggc
tatgtgtcggccgggacggtcgagtggctgtactcgccagagacggatacgtttgcgttc
ctggagctgaacccgcggctgcaggtcgagcacccgacgacagagatggtgacgggcgtc
aacataccggcggcgcagctgcagattgcgatggggattccgctgcagcacatagacgac
gtgcgcgagctgtacgggctggggcgcgtggacgagcggggtcaacgctgtggcgcgccg
tcggcacgaacgagcatagactttgacgcgcggcaccagagcgtcgacacgagtccgaag
ccgcgtgggcacgttatcgcgtgtcggatcacggcagagaacccggacacgggcttcaag
ccggggatcggctcgttgagcgagctgaatttccgatcgtcgccgtcgacgtgggggtac
tttagtgtgagcacgagtggcgcgctgcacgagtatgcggactcgcagtttgggcatgtg
ttttcgtatggcgcagaccgcgaggaggcgcggaagaacatggtgtttgcgctgaaggag
ctgtcgatccgcagcgactttcacacgacgaccgagtacctcgtgatgctgctggagcag
gatgtgtttgtgcagaaccaagtgacgaccgcgtggctcgatggcctcatagagaacagc
gtgacggcgcgccggccgccgacggagctcgccgtgctgtgcggtgctgccgtcaaggcg
catgcgctcgcgaaggagtcgcgtgacgaattcaagcgtatcctgcaccgtggacaggtg
ccgccgcggaacacggtgcggaccaagttttccgtcgagtttatctacggcaatgtcaag
taccagtttgttgcgaagcagagcgcgccgacaagctggacgctgcacctgcagcagcag
cagcagcaggtgcacgtgtcgctgcgggacctaagtgacggtggcctgctcattggactc
tcaggcgcatcccacaccgtgtactggttcgacgaggtcgggcaaacgcggctcgtgatc
gacgggcagacgtgccgcatggaggaggagcgcgatccgacgcagatctgctcgccttcg
cccgggaagctc

DBGET integrated database retrieval system