KEGG   Malassezia globosa: MGL_3561Help
Entry
MGL_3561          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mgl  Malassezia globosa
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MGL_3561
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGL_3561
   00640 Propanoate metabolism
    MGL_3561
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MGL_3561
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    MGL_3561
Enzymes [BR:mgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MGL_3561
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MGL_3561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 704 aa AA seqDB search
MSRSRSRVEEHFVGAVSPEHAQSSETGRRVGDFVRAAGGHSVITKVLICNNGIAAVKEIR
SVRKWAYDMFGDERAIQFTVMATPDDLRINADYIRMADKYVEVPGGPNANNYANVELIVD
IAERAGVHAVWAGWGHASENPRLPEMLARLEPRILFLGPPGTAMRALGDKISSTIVAQHA
DVPCLPWSGTGITETIQSTEGYVSVPDDAYERACVHSAEEGLAIAQRIGFPVMIKASEGG
GGKGIRKCVSPDMFVQLYQAAVGEVPGSPVFVMKLASAARHLEVQVLADQYGQAISLFGR
DCSVQRRHQKIIEEAPVSIAPAETRLRMEQAAVRLAKLVGYVSAGTVEWLYSPETDTFAF
LELNPRLQVEHPTTEMVTGVNIPAAQLQIAMGIPLQHIDDVRELYGLGRVDERGQRCGAP
SARTSIDFDARHQSVDTSPKPRGHVIACRITAENPDTGFKPGIGSLSELNFRSSPSTWGY
FSVSTSGALHEYADSQFGHVFSYGADREEARKNMVFALKELSIRSDFHTTTEYLVMLLEQ
DVFVQNQVTTAWLDGLIENSVTARRPPTELAVLCGAAVKAHALAKESRDEFKRILHRGQV
PPRNTVRTKFSVEFIYGNVKYQFVAKQSAPTSWTLHLQQQQQQVHVSLRDLSDGGLLIGL
SGASHTVYWFDEVGQTRLVIDGQTCRMEEERDPTQICSPSPGKL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcacgttcaagagtcgaggagcatttcgttggcgctgtatcgccggagcat
gcacagtcgtcggagacagggagacgggtgggcgactttgtgcgtgctgcgggagggcac
agtgtgatcacgaaggtgcttatatgcaacaatgggattgcggccgtgaaagagatccgc
tctgtgcggaaatgggcgtatgatatgtttggtgatgagcgggcgatccagtttacagtg
atggcgacgcccgatgacttgcggatcaatgctgactacatccgcatggccgacaagtat
gtcgaggtccctggtggaccgaatgcgaataactatgcaaatgtcgagttgattgtggat
atagcggaacgagcaggcgtgcatgccgtgtgggcaggctgggggcatgcgtcggagaat
ccgcggctgcccgagatgctagcgcgtctggagccacggatcctgttcctggggccgccg
ggcacggcgatgcgtgcgctgggcgacaagatttcgtcgacgattgtggcgcagcacgca
gacgtgccatgcctgccatggtctggcacaggcatcacggagacgatacaaagcacggag
ggatatgtgagcgtgccggacgatgcgtacgagcgagcgtgtgtgcactcggcagaagag
gggctggcgattgcgcagcgcataggctttcccgtgatgatcaaggcatcggaaggaggc
ggtggcaagggcatccggaaatgcgtgtcgccggacatgttcgtgcagctgtaccaagcg
gctgtgggcgaggtgccggggtcgccggtgtttgtgatgaagctcgcgagcgcagcgcgg
cacctggaggtgcaggtgctggcggaccagtacggccaggcgatcagtttgttcgggcgc
gactgctcggtgcagcggcggcaccaaaagatcattgaggaggcgcccgtgagcatagcg
ccggcagagacgcgcctgcgtatggagcaagcggctgtgcggctcgcgaagctcgttggc
tatgtgtcggccgggacggtcgagtggctgtactcgccagagacggatacgtttgcgttc
ctggagctgaacccgcggctgcaggtcgagcacccgacgacagagatggtgacgggcgtc
aacataccggcggcgcagctgcagattgcgatggggattccgctgcagcacatagacgac
gtgcgcgagctgtacgggctggggcgcgtggacgagcggggtcaacgctgtggcgcgccg
tcggcacgaacgagcatagactttgacgcgcggcaccagagcgtcgacacgagtccgaag
ccgcgtgggcacgttatcgcgtgtcggatcacggcagagaacccggacacgggcttcaag
ccggggatcggctcgttgagcgagctgaatttccgatcgtcgccgtcgacgtgggggtac
tttagtgtgagcacgagtggcgcgctgcacgagtatgcggactcgcagtttgggcatgtg
ttttcgtatggcgcagaccgcgaggaggcgcggaagaacatggtgtttgcgctgaaggag
ctgtcgatccgcagcgactttcacacgacgaccgagtacctcgtgatgctgctggagcag
gatgtgtttgtgcagaaccaagtgacgaccgcgtggctcgatggcctcatagagaacagc
gtgacggcgcgccggccgccgacggagctcgccgtgctgtgcggtgctgccgtcaaggcg
catgcgctcgcgaaggagtcgcgtgacgaattcaagcgtatcctgcaccgtggacaggtg
ccgccgcggaacacggtgcggaccaagttttccgtcgagtttatctacggcaatgtcaag
taccagtttgttgcgaagcagagcgcgccgacaagctggacgctgcacctgcagcagcag
cagcagcaggtgcacgtgtcgctgcgggacctaagtgacggtggcctgctcattggactc
tcaggcgcatcccacaccgtgtactggttcgacgaggtcgggcaaacgcggctcgtgatc
gacgggcagacgtgccgcatggaggaggagcgcgatccgacgcagatctgctcgccttcg
cccgggaagctc

DBGET integrated database retrieval system