KEGG   Malassezia globosa: MGL_3593Help
Entry
MGL_3593          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
mgl  Malassezia globosa
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mgl03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MARVVHLSSFQMVTFSSEVAEGKLLSKFHTPTKRKEPEESDDTHKKIKCSPIEIDSSNLP
VPLLPSAQEPSYLCQWRAPQTRKHKTWDGDAILVVHENNKTCSLRSIHDGSMLITNASLR
KRTVNEGDEFYVGGKEVLIERSMSGLIGDQGQNFGAQTHATSVPRHGPSMFSLPPRQKPI
PASQFYSTPKSAITSTSSTLSAYRYSRSEPQSKFDSSSPDAVVMKRPNDKHYELFGKGCP
IVDVVLDPELAPNLRPHQIEGVKFMYEAVTGISSLENGHASPGQGVILADEMGLGKTLQT
IALISILIHQNCYFSPLRTGTVDKVLIVCPLTLVVNWKREFRKWLGRNSIGVLAVEGDGR
IEVEQFVNSRQYQVLILGYERLRSSVQRLSRAIPAIGLVICDEGHRLKSRDTKTTRCFDI
LQTRRRILLTGTPIQNDLREFYTMVDFVYPGLFDQYSVFKRVFEDPIMRSRAQHCSSQAL
ELGKKRNKAVCI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgtcgtacatctaagctccttccagatggtgactttttcttctgaagtagct
gagggtaagcttctctcgaagtttcatactcctaccaaaaggaaagagcccgaagaatct
gatgatacccataaaaaaataaaatgctcgccaattgaaatcgattcgtcgaatttgccc
gtgccgcttttaccttcagcgcaggagccgagttatctgtgtcaatggcgagcgccacag
acgcgtaaacataaaacttgggacggtgatgcaattcttgttgttcatgagaataacaag
acatgctcacttcgatctattcatgatggctcgatgctgataacaaatgcatcgctccga
aaacgaactgtcaacgaaggggacgagttttatgttggaggcaaggaggtattaattgag
cgctccatgagtggcttaattggcgatcaaggtcaaaatttcggtgctcagacacacgcc
acatctgtaccgcggcatggcccttccatgttctctctaccgccgcgccaaaaacctatt
cctgcttcacagttctattcaacacccaaatcggctataacatcgacgtctagtactcta
tcagcttacagatactcaagatcagagccgcagtcaaaatttgattcgtcctctccagac
gcagttgttatgaaacgtccaaatgacaaacactacgagctgttcggtaaaggctgtcca
attgttgacgtcgttctcgatcctgaactggctccgaatttaagaccccatcaaattgaa
ggtgttaaatttatgtatgaagccgtgactggcataagctcgcttgaaaatggccacgcc
tcgcctggacaaggtgtaattcttgctgatgagatgggccttggtaaaacccttcaaaca
attgctctcatatccattttaattcatcaaaattgttacttttctcctcttcgcaccggt
acagtggacaaagtgttgatagtatgtccattgactttggttgtaaattggaagcgcgaa
tttcgcaagtggttgggaagaaattctattggggttttggccgtagaaggcgatggacga
attgaggtggaacaatttgtgaacagcagacaataccaagttctgattcttgggtatgaa
cgacttcgaagctcggtccagcggctatcgcgcgctataccggccattggtttagtgatc
tgcgatgagggacatcgtctgaaatcaagggacacaaaaacgacgcgatgtttcgatatt
cttcaaacgagacgtcgtatattgctcaccggaacgcctattcaaaatgacttgcgcgag
ttttataccatggtggattttgtgtatccgggtctctttgatcagtatagtgtcttcaaa
cgggtgtttgaagatccaattatgcgtagtagggcccagcactgctcctctcaagcactg
gaactagggaaaaagcgaaacaaagcagtatgtatttga

DBGET integrated database retrieval system