KEGG   Malassezia globosa: MGL_3609Help
Entry
MGL_3609          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mgl  Malassezia globosa
Pathway
mgl00220  Arginine biosynthesis
mgl00250  Alanine, aspartate and glutamate metabolism
mgl01100  Metabolic pathways
mgl01200  Carbon metabolism
mgl01210  2-Oxocarboxylic acid metabolism
mgl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MGL_3609
   00220 Arginine biosynthesis
    MGL_3609
Enzymes [BR:mgl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MGL_3609
Amino acid related enzymes [BR:mgl01007]
 Aminotransferase (transaminase)
  Class I
   MGL_3609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 5853448
NCBI-ProteinID: XP_001729142
UniProt: A8QA50
AA seq 500 aa AA seqDB search
MSRPRQTFRKDTINPSILEVEYAVRGEIPTKAAEYERRLETGEKLPFGSIVWTNIGNPQQ
QPMLGQEPITFWRQVASLTEYPQLLDLPAHVRDATFPTDTQERARQLLDAFGSVGAYTAS
KGVPLVRQHVAEFLAARDGFDEDLENIYLTAGASAGISLLFQVLFRAKRDGILIPIPQYP
LYSASVSLLDLVPMHYHLNAEQHWDPSISNIKTQIDEARKNGIEPRAIIMINPGNPTGNC
MTREQIGNVIRLAYEESLAIFADEVYQENIYQNRRPFVSFRQVLLDLKNSSDATERHISE
TVELASFHSISKGMVGECGRRGGFFVLNNFDREVEGQINKIASIALCPPVQGQIGVDLMV
RPPKPGDPSYELWNSQMQSIFQTLNKRSKRIAESLTKLPGIEADPAMGAMYVFPRVHLPK
SVAEEAQRNGKKVDEFYCRKLLDETGICVVPGSGFGYEPEVLDDGSTYSYFRTTVLAKET
QAFIDRFTAFHVAWMKKHKD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggcctaggcaaacatttcgtaaagataccatcaatccttctatcttagaagta
gaatacgccgtgcgtggagaaatccccacaaaagccgcggagtatgagcggcgcctcgag
acaggtgaaaagctcccatttggatctatcgtgtggacgaacatcggcaatccacaacaa
cagccaatgctaggacaagaacctatcactttttggcgtcaagtggcttcactgacagag
tatccccagctgttagacttgccagcacatgttcgtgatgctacgttcccaaccgataca
caagagcgcgcgcgtcaattgcttgatgcctttggaagtgttggcgcctatacggcatcg
aaaggtgtgccgctggtgcgtcagcatgttgcggaattcctagcagcccgtgatggattt
gacgaagacttagaaaacatctatcttacggctggtgcgtccgcggggatctcgttgcta
ttccaagtgctgtttcgtgcgaagagagatggtattctgatacctatccctcaatacccg
ttatactcggcgtctgtatcgctactggatttagtgccaatgcactaccatttgaatgca
gaacaacattgggacccgtctatatccaacatcaagacacagatcgacgaagcacgtaag
aatggcattgagccgcgcgctattattatgatcaatcccggaaatcccactggtaactgt
atgacacgtgagcagattggcaatgtgatcaggttggcttacgaggagagcttggctatt
tttgccgacgaagtgtatcaagagaatatataccagaaccggcgcccgtttgtctcattc
cgccaagtacttttggatcttaaaaacagctctgatgccacagagcgtcatattagtgag
accgtcgagcttgcatcgttccacagtatcagcaagggcatggtgggagaatgcggtcga
cgtgggggatttttcgttttgaacaattttgacagagaagtggaaggacaaatcaataag
attgccagtattgcactctgtccacccgtgcaaggccaaatcggagttgatttgatggtt
cgtccaccaaagccgggtgatccaagttacgagctttggaattcgcaaatgcagtcgatt
ttccagaccctcaataaacggtcaaagcgaattgctgaaagcttaaccaagctccctggt
attgaagcagaccctgctatgggtgctatgtacgtttttcctcgtgtgcatcttccaaag
tctgtggccgaagaggcgcaaagaaatgggaaaaaagtagatgagttctactgtcgtaaa
cttctggatgaaactggtatttgtgtggttcctggttctggattcggctatgagccagaa
gtgctggacgatggatcgacatactcatatttccggacgaccgttctagcgaaagagact
caagcttttatcgatcgttttacagcattccacgtagcctggatgaaaaagcacaaagat
tga

DBGET integrated database retrieval system