KEGG   Malassezia globosa: MGL_3609Help
Entry
MGL_3609          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mgl  Malassezia globosa
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mgl01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mgl01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgl01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mgl00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 500 aa AA seqDB search
MSRPRQTFRKDTINPSILEVEYAVRGEIPTKAAEYERRLETGEKLPFGSIVWTNIGNPQQ
QPMLGQEPITFWRQVASLTEYPQLLDLPAHVRDATFPTDTQERARQLLDAFGSVGAYTAS
KGVPLVRQHVAEFLAARDGFDEDLENIYLTAGASAGISLLFQVLFRAKRDGILIPIPQYP
LYSASVSLLDLVPMHYHLNAEQHWDPSISNIKTQIDEARKNGIEPRAIIMINPGNPTGNC
MTREQIGNVIRLAYEESLAIFADEVYQENIYQNRRPFVSFRQVLLDLKNSSDATERHISE
TVELASFHSISKGMVGECGRRGGFFVLNNFDREVEGQINKIASIALCPPVQGQIGVDLMV
RPPKPGDPSYELWNSQMQSIFQTLNKRSKRIAESLTKLPGIEADPAMGAMYVFPRVHLPK
SVAEEAQRNGKKVDEFYCRKLLDETGICVVPGSGFGYEPEVLDDGSTYSYFRTTVLAKET
QAFIDRFTAFHVAWMKKHKD
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggcctaggcaaacatttcgtaaagataccatcaatccttctatcttagaagta
gaatacgccgtgcgtggagaaatccccacaaaagccgcggagtatgagcggcgcctcgag
acaggtgaaaagctcccatttggatctatcgtgtggacgaacatcggcaatccacaacaa
cagccaatgctaggacaagaacctatcactttttggcgtcaagtggcttcactgacagag
tatccccagctgttagacttgccagcacatgttcgtgatgctacgttcccaaccgataca
caagagcgcgcgcgtcaattgcttgatgcctttggaagtgttggcgcctatacggcatcg
aaaggtgtgccgctggtgcgtcagcatgttgcggaattcctagcagcccgtgatggattt
gacgaagacttagaaaacatctatcttacggctggtgcgtccgcggggatctcgttgcta
ttccaagtgctgtttcgtgcgaagagagatggtattctgatacctatccctcaatacccg
ttatactcggcgtctgtatcgctactggatttagtgccaatgcactaccatttgaatgca
gaacaacattgggacccgtctatatccaacatcaagacacagatcgacgaagcacgtaag
aatggcattgagccgcgcgctattattatgatcaatcccggaaatcccactggtaactgt
atgacacgtgagcagattggcaatgtgatcaggttggcttacgaggagagcttggctatt
tttgccgacgaagtgtatcaagagaatatataccagaaccggcgcccgtttgtctcattc
cgccaagtacttttggatcttaaaaacagctctgatgccacagagcgtcatattagtgag
accgtcgagcttgcatcgttccacagtatcagcaagggcatggtgggagaatgcggtcga
cgtgggggatttttcgttttgaacaattttgacagagaagtggaaggacaaatcaataag
attgccagtattgcactctgtccacccgtgcaaggccaaatcggagttgatttgatggtt
cgtccaccaaagccgggtgatccaagttacgagctttggaattcgcaaatgcagtcgatt
ttccagaccctcaataaacggtcaaagcgaattgctgaaagcttaaccaagctccctggt
attgaagcagaccctgctatgggtgctatgtacgtttttcctcgtgtgcatcttccaaag
tctgtggccgaagaggcgcaaagaaatgggaaaaaagtagatgagttctactgtcgtaaa
cttctggatgaaactggtatttgtgtggttcctggttctggattcggctatgagccagaa
gtgctggacgatggatcgacatactcatatttccggacgaccgttctagcgaaagagact
caagcttttatcgatcgttttacagcattccacgtagcctggatgaaaaagcacaaagat
tga

DBGET integrated database retrieval system