KEGG   Malassezia globosa: MGL_3614Help
Entry
MGL_3614          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
mgl  Malassezia globosa
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mgl00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 411 aa AA seqDB search
MSAAAVNQAAETRADLEKKRNGVKHANSLLKDIVTMRWLVYPASAAKIALIFVLGYMMFE
YALPFSVNPFQPFLTLSYRIPESEVVLRLAQNPIYGPTPSYSLDNPVTTALRDFFRSTHA
KLFPNEPKLLRYGKGWLDVCFMGFYIIVFSFLRQVITGHIFKPLAARWNLKTENKCVRFA
EQGYALTYWGVMSIFGLYVMAFQDSWWYNLDHLWYQYPHWQMRPELKLYYLLQASYWLQQ
AFVMLLGLERPRKDYYELVAHHLVTLWLIGWSYFINLSMIGTTVFVCMDIPDTWLALSKM
LNYLNKNMAAAAVYSVFMVVWSYFRIFLSALTLYSVYADYTKIPAYARTFHPSQGHWLVW
WMQCHVFAPLFLLLLLNLFWYALMWRILYRAINGVYGDTREEGEDDHGKEE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgcagctgtgaaccaggctgcagaaacgcgcgcagatctggaaaagaaacgg
aacggagtgaaacatgcaaatagcttgctcaaggacattgtgacaatgaggtggctagtg
tatcctgcatcagctgccaagattgcgttgatctttgttcttggctacatgatgtttgaa
tatgcgctgccattcagtgtgaacccattccaacctttcttaacgctatcataccgaatc
ccggagtccgaggttgtcttgcgtcttgcacagaacccgatatacggccctacaccttcc
tactctctggacaaccctgttactactgccttgcgagactttttccggtcgacacatgcg
aagctctttccaaatgagcccaagttattgcgctacggtaaaggttggctcgatgtttgt
ttcatggggttctacattattgtttttagctttctccgccaggtcattacgggtcacatc
ttcaagcctctggctgcgcgctggaacctaaaaactgaaaacaagtgtgtgcgcttcgcc
gaacagggctatgcattaacttactggggagtgatgagtatttttggtctgtacgttatg
gcattccaggatagttggtggtacaaccttgaccatctttggtaccaatacccgcattgg
caaatgcgccctgagcttaagctatattacttgcttcaggccagttattggcttcaacaa
gcattcgtaatgcttttgggtcttgagcgtccccgtaaagattattacgagcttgttgca
caccatttagtgacgctctggttgattggatggtcgtatttcatcaacttgtccatgatc
ggcactaccgtgtttgtctgcatggatattccggacacatggcttgctctctcaaaaatg
ctgaattatcttaacaaaaatatggctgcagcagcggtttactcagtctttatggtggtc
tggtcctatttccgaattttcctgagcgctctcactctttactccgtctatgctgactat
accaagattcctgcttatgcgcgaacattccatccatcccagggtcattggctcgtttgg
tggatgcagtgccatgtatttgctccgctcttcttactccttcttcttaatttgttctgg
tatgcccttatgtggcgaatcctataccgtgcaattaacggcgtctacggcgacacgcgc
gaggaaggtgaagatgaccatggaaaagaagaataa

DBGET integrated database retrieval system