KEGG   Malassezia globosa: MGL_3686Help
Entry
MGL_3686          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mgl  Malassezia globosa
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mgl00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MKSAARPAQYMRQFSSGKTNANAPSSNLGLYLSAGGVAGLGAWYAMGGFNGDIRSKIQQV
NADSGDVALSGDEFRALKLKEVRPYNHDSSFYVFELPDNKRSGIFTASALVIRGAGEEPK
DKDGKPVIRPYTPVNPPTDKGELVLLIKHYPQGQMTQYLKSLKAGDEMHFKGPIPKHPYK
ANQFEEIGMVAGGSGITPMWQLIQEISSNPADKTKVTLLYGNKTEADILLREKFDEISKD
DRFKIVYFLDEASKNMKAEKGFITKEHIQKYLPGADKGEKAKIFVCGPPPMLKAVAGPKK
GFQQGELSGALADLGFKSEQVFKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgcggctcgtccagcccagtacatgcgtcagttctcatcgggcaagacgaat
gcgaacgccccatcgtcgaacttgggtctgtatctctcggccggtggtgtcgctggtctt
ggtgcatggtacgcgatgggcggctttaatggcgatatccgctcgaagatccagcaggtg
aacgccgactcgggtgacgtagctctctcgggtgatgagttccgtgcgttgaagctcaag
gaggtgcgcccatacaaccacgacagctcgttttacgtgttcgagctgccggacaacaag
cgttcgggtatctttactgcatctgcgcttgtgatccgtggcgctggtgaggagcccaag
gacaaggatggaaagcccgtcattcgtccctacacacccgtgaacccgccgaccgacaag
ggcgagcttgtgttgctcatcaaacactacccgcagggccaaatgacgcagtatctcaag
agcttgaaggccggtgatgaaatgcacttcaagggccctattcccaagcatccttacaag
gccaaccaatttgaggagatcggcatggttgccggtggttcgggtatcacccccatgtgg
cagctgattcaggaaatctcgtcgaacccagctgacaagacgaaggtcacgctcctttat
ggtaacaagacggaggctgacatccttctgcgcgagaagttcgatgagatcagcaaggac
gaccgcttcaagattgtctactttttggatgaagcatcgaagaacatgaaggcagaaaag
ggctttatcaccaaggagcacatccagaagtatcttcctggtgcggacaagggcgaaaag
gccaagatctttgtctgtggtcctccgcccatgctgaaggcggtggctggcccgaagaag
ggattccagcagggcgaactgtctggtgctcttgctgacttgggtttcaagtctgagcaa
gtgttcaaattctaa

DBGET integrated database retrieval system