KEGG   Malassezia globosa: MGL_3743Help
Entry
MGL_3743          CDS       T01043                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
mgl  Malassezia globosa
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 5853582
NCBI-ProteinID: XP_001729276
UniProt: A8QAI4
AA seq 107 aa AA seqDB search
MGFSDGDAKKGAGLFKTRCAQCHTTEEGGPNKVGPNLHGIFGRKSGQAEGFSYTAANVNK
GVTWDENTLFEYLENPKKYIPGTKMAFNGLKKDKDRNDLITFLREAC
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggtttttctgacggtgacgctaagaagggtgctggtctgttcaagacccgttgcgct
cagtgccacaccacagaggagggtggccctaataaggtcggtcctaacctgcacggtatc
tttggccgcaagagtggccaggctgaaggcttcagctacacggctgccaacgtgaacaag
ggtgtgacatgggatgagaacaccctattcgagtacctggagaaccctaagaagtacatt
cctggtacgaagatggcattcaacggtcttaagaaggacaaggaccgcaacgaccttatc
acgttcttgcgtgaggcctgttaa

DBGET integrated database retrieval system