KEGG   Malassezia globosa: MGL_3743Help
Entry
MGL_3743          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
mgl  Malassezia globosa
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mgl00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 107 aa AA seqDB search
MGFSDGDAKKGAGLFKTRCAQCHTTEEGGPNKVGPNLHGIFGRKSGQAEGFSYTAANVNK
GVTWDENTLFEYLENPKKYIPGTKMAFNGLKKDKDRNDLITFLREAC
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggtttttctgacggtgacgctaagaagggtgctggtctgttcaagacccgttgcgct
cagtgccacaccacagaggagggtggccctaataaggtcggtcctaacctgcacggtatc
tttggccgcaagagtggccaggctgaaggcttcagctacacggctgccaacgtgaacaag
ggtgtgacatgggatgagaacaccctattcgagtacctggagaaccctaagaagtacatt
cctggtacgaagatggcattcaacggtcttaagaaggacaaggaccgcaacgaccttatc
acgttcttgcgtgaggcctgttaa

DBGET integrated database retrieval system