KEGG   Malassezia globosa: MGL_3853Help
Entry
MGL_3853          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mgl  Malassezia globosa
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mgl00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 769 aa AA seqDB search
MVQDTRQSRHRNASASRKAKLAPKVNESEKTSVSSLYGLSPAMVNTAITVGLCATAFYVR
AYQIELPNEVVFDEVHFGKFAAYYVTRRYFFDVHPPLAKMMIAAVAWLAGFDGKFEFDNI
GDSYIENNVPYKPIRLFIAAVGSLHVPLVFQILRETGTSTTMALIAALAILFDNAQVLQS
RLILLDAPLVLFVLCSLYSYVKFYAQRYRPFQPAWWAWLTATGVSLALTISCKMVGLLTF
FTIGGAVLFDLWNLLDIRRGLSMRVFVKHFCARALCLIVVPFLIYLSFFYIHFSVLTQTG
SGDDFMSLEFQQTLNGNEYLETPISIHAYDSITLRHVGTNAYLHSHPSRYPLEYEDGRIS
SEGQQVTAYEHQDDNNLWRIEPVEPVDNEDGSFNETRRMIHHNQLIRLLHLGTNTYLMTH
DVASPLMMTNMEFTTVSGDNEQEYANTLFKVMVEGATTDDIAWDSRRTSVRLVHNDTGVV
MWTRADGRLPDWGYGQLEVNGDKNQREKTAIWTAMDVRPDPESPLFESRSNIPQEPLAPI
PRSFLQKYTELQGLMLSHNNQLTSSHPYDSRPQSWPVVYDGVAYWSKDEAQEQIAFFGNV
VSWWCASFAVLAFVAIFFTDLLCRRRGLYYLSTAERCRYLHTTGFFVYAWACHYVPFFLM
HRQLFIHHYLPAHACSVLVFAGMLDFVTSRSIDLPITPAGPELPAERRRPVMRRRQGRLA
QGFAFVFVLSLVAMFQFLSPFTYGNVGLSEAEVRARQILPSWRLQFLKN
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggtacaggacactagacagtcacgccatcggaatgcatctgcatcccgcaaggctaag
ctggcaccgaaagtgaatgagtctgagaaaactagcgtgtcgtcgctttatggcttatct
ccagcgatggtaaataccgccattactgttggcctttgtgctaccgccttttacgtgcgt
gcctatcagattgaattgccaaatgaggtggtgtttgatgaagtgcacttcggaaagttt
gctgcgtactacgtgaccagaagatacttttttgatgtgcacccaccgctagcgaaaatg
atgattgcagccgttgcgtggcttgctgggttcgacggcaagtttgaatttgataacatc
ggtgattcatacattgaaaataacgtaccatacaaaccaattcggctgttcattgctgct
gtcggctcactgcatgtgccgctcgtgttccagatcttgcgtgagactggcacatcgacc
accatggcgctcatagcagcactagccatcttgtttgacaatgctcaggtgttacaatcg
cgactgatcctgctggacgcgcctcttgtcctgtttgtcctgtgcagcttgtattcgtat
gtcaagttctacgcacagcgctaccgcccattccaacctgcttggtgggcgtggctgaca
gcaacgggcgtgagcttggcattgacgatctcgtgcaaaatggtcggcttgctgacattc
tttacgattggtggtgccgtactatttgatctttggaatttgttggacatccgccgtggt
ctttctatgcgtgtgttcgtaaagcacttctgtgcacgagctttatgccttattgtggtc
ccgttcctgatctatctaagcttcttctacatccatttctccgtactcacacaaaccggc
tcgggcgatgatttcatgagtctagagttccaacagacactcaatggcaatgaatacttg
gagacacccatcagcatccacgcatacgactctatcactcttcgacacgtgggcacgaat
gcatatctccattctcatccgagcaggtacccgctggaatatgaggacggtcggatctcc
tctgaaggccagcaagtcactgcctatgagcaccaggacgacaacaatctttggaggatc
gagcccgtcgagccagtcgacaacgaagatggctcattcaatgagactcgccgcatgatt
catcacaaccagttaatccgactcttgcatcttggaacgaacacatatcttatgacgcat
gacgtggcatctcccctaatgatgacgaacatggagttcacaacagtctccggcgacaac
gagcaagaatacgccaacaccttgtttaaggttatggtcgaaggtgctacgactgatgac
attgcttgggatagtcgccgtacatcagtgcgcctcgtacacaatgacacaggtgttgtc
atgtggactcgcgcggacggccgtcttcctgactgggggtatggacagcttgaagtgaat
ggcgacaagaaccaaagagaaaagacggctatctggactgccatggacgttagaccggac
cctgagtcaccgttgttcgagagccgctcgaacattccacaagaacctcttgctcctatc
ccgcgaagcttcctccaaaagtacactgaattacagggcctcatgctatcacacaacaat
caactcacaagcagtcacccatacgatagccggccacagtcgtggcccgttgtgtacgat
ggcgtcgcatattggtcgaaggacgaggcgcaggaacaaatcgcctttttcggcaatgtc
gtcagttggtggtgtgcatcctttgctgttcttgctttcgttgccatctttttcactgac
ttgctttgccgccgccgtggcttgtattacttgtcgacggccgagcgatgtcgttacttg
cacacaacgggcttctttgtgtacgcatgggcatgtcattatgtgccattctttcttatg
catcgacaacttttcattcaccactatcttcctgcgcatgcatgctcagtgcttgtcttt
gcaggcatgctggactttgtcacgagccgctctatcgacctaccgattactcctgcggga
ccggagctcccagcggagcgacgtcgcccggtgatgaggcgacgtcagggccgtttggcc
cagggctttgcgtttgtcttcgttctttccctggtggccatgttccaattcctctcgccc
ttcacatatggaaacgtcggtttgagtgaagcggaagtccgcgcccgacaaattctgcct
tcctggcggctccagtttcttaaaaactaa

DBGET integrated database retrieval system