KEGG   Malassezia globosa: MGL_3860Help
Entry
MGL_3860          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
mgl  Malassezia globosa
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MGL_3860
Enzymes [BR:mgl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MGL_3860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 707 aa AA seqDB search
MALGPALACTDESGCINRLTQVECLRDVCRCGVHCANQRFQQHAYAKVDIVKTPDKGYGL
RAQTDLGRDEFVYEYIGEVINHDTFMRRMAQYKTEHIEHFYFMMLQRDEYIDATKRGGRS
RFINHSCSPNCYVSKWHVGRHVRMGIFAKRRILAGEELTFNYNVDRYGNDPQPCYCGEPN
CVGTLGGRTQTDVVTMDDRFITALGIADQVAQLRASLPRGKRSKILDEDFSPTLHAIAED
ECARVMTVMRDATANRKMVQMLLTRVRLTDDISVHKMLVKMHGFVVMAGVLDEWVDDWEL
VHLALQCLEKWPLLARDKVVDSGVGLQVQQILEACKRESESEKKFEGHLSKVAMLAQYLV
HKWEQLPTTFRIARKDGTEEDEDGGAWAARRRAQASSSTQASHDDTTSSAVSEELRRSLL
AYRDADKNVPTAPDVPRSSRMKEEPRKKDEAQMHKNSLPSIEDIIRRANEDSEAQQKRLL
QQQELELEEQKREKERKEREKKKRRAKQHDEMRGGQDMASTSASKRASPSSSESHIVHKD
KRARSASAHEDTDIETLERHLRKLVGALVIKQMSKVRDQLDRERFKRHAKEVSTKSVSPL
TLLLQLTQVLCDKEKRNPKTWPPRLPEGQPGLRELSEDKRKKMKIFAHEYIKKLLRHKSK
AHMSADTSADLSTQPDTSVDASIDLGSPSSSTTKKPSSPSLSPPSDT
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggcacttggacctgcgttggcgtgtactgacgaatcgggatgcattaatcgactcaca
caagttgaatgcttgcgagatgtgtgccgatgtggcgtgcattgtgcgaaccagcggttc
caacaacatgcatatgccaaagtagacatcgtaaagacgcccgacaaagggtatggactg
cgagcacaaacggacctgggacgtgacgagtttgtgtacgagtacatcggcgaggtaatt
aatcacgatacgtttatgcgacgcatggcgcaatacaaaaccgaacacattgaacatttt
tactttatgatgctgcaacgcgacgagtacattgatgcaacaaagcgtggtgggcgctcg
cgcttcatcaaccacagttgcagtccaaattgctacgtgagcaagtggcatgtgggacgg
catgtgcggatgggtatctttgctaagcggagaatcctcgcgggcgaggagcttacgttc
aattataatgtcgatcgttatggcaacgatccgcagccctgttattgtggcgagccgaac
tgtgtgggtacgctcggcggccgaacgcagaccgatgtggtgacgatggatgaccgcttt
atcacggcgctcggcatcgctgatcaagttgctcagctgcgtgcatcactacccaggggg
aaacggagtaaaattctcgacgaagacttttctcccacgctgcacgccatcgctgaggat
gaatgtgcacgagtcatgacggtcatgcgcgatgcaaccgcaaatcgcaagatggtccaa
atgctcttgacacgtgtgcgactgacagatgatatctctgtgcacaagatgctggtgaaa
atgcacggattcgttgtgatggccggtgtgttggacgagtgggtcgatgactgggaactc
gtccatcttgcactccagtgcttggagaaatggcctctcctagctcgcgacaaggtcgtt
gactctggcgtgggtctacaggtgcaacagatcttagaagcttgcaagcgagagtcggaa
tcggaaaagaagttcgagggacatctgtcgaaagtagccatgctcgcacaatatctcgtt
cacaagtgggagcagctcccaaccacgtttcgcatcgcacggaaagacggcacggaagag
gatgaagatggcggggcgtgggcggctcgtcgacgtgcccaagcgtccagttctacacag
gcatcgcatgacgataccacaagctcggcagtgtctgaagaactcagacgctctttgctt
gcttaccgtgatgccgacaagaatgtacccaccgctcctgacgtcccacgtagctcgcgt
atgaaggaagaaccgaggaagaaagatgaagctcagatgcataaaaattctcttccatcc
attgaggacatcatccgccgtgcgaatgaggacagcgaggcccaacagaagcggctgttg
caacagcaagaactggagctggaagagcagaaaagagagaaggaaaggaaagaaagagaa
aagaagaaaagaagggcaaagcaacatgatgagatgcgtggtggacaagatatggcaagt
acatcggcgtccaagcgtgcaagcccgtcttcctcagagtcacacattgtccataaagac
aagcgagcacgttcagcgtcagcccatgaagacactgatatagagacgctcgagcggcac
ctacgcaagcttgttggtgcgctagtcatcaagcaaatgtccaaggtccgggaccagctg
gatcgcgagcgattcaaacggcatgccaaagaggtgagtaccaaatcagtaagtccatta
accctacttctccagttaacacaagtgctgtgtgacaaagagaagcgcaaccccaagaca
tggccaccgcgtttgcctgagggccaaccgggtttgagagaactcagtgaagataaacgt
aaaaaaatgaagatatttgcgcatgaatatattaaaaagcttcttcgtcacaagagcaaa
gcacatatgagtgccgataccagtgccgatctatctacgcagcctgatacaagcgttgat
gcgtcaatagatcttggctcaccctcctcatcaaccaccaaaaaaccgtcatccccttca
ctctcgccaccatcagatacctag

DBGET integrated database retrieval system