KEGG   Malassezia globosa: MGL_3979Help
Entry
MGL_3979          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mgl  Malassezia globosa
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:mgl04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 212 aa AA seqDB search
MEFCEAGSMDSIYRRVKSRGGRVGEKVLAKLAESILKGLEYLHQRRIIHRDVKPSNILVT
RNGQMKLCDFGVSGELINSVAGTFTGTSTYMAPERIMGRPYTITSDVWSLGVTILELALN
RYPFAEEGEAPMGPIDLLFFLLNSPLPTLEDTEQIRWSRSLRDFVDRCLERDGAIRVAPL
TLLAHPLIRRAEHISNTDMARFVASVWRWDYN
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaattttgtgaggctggcagtatggactctatctaccggcgagtcaagtcacgcggt
ggccgcgttggagagaaagtcctggccaaattagccgagtctatcctcaagggactcgaa
tacctgcatcagcggcgaatcattcatcgggatgtaaagccgagtaacattcttgtcacg
cgcaatggtcagatgaagctgtgtgattttggtgtgtcgggtgagcttatcaacagtgtg
gctggtacattcacaggcacatcgacgtatatggcgccagagcgcattatgggtcgtccc
tataccattacgtcggatgtatggtctctgggtgtgacgattctagaacttgctttgaac
cgatatccctttgccgaagaaggtgaggcgccaatgggacctatcgatttgctttttttc
ttgttgaactcgcctttgcccactttggaagacacagagcaaattcgatggagtcgttcc
ttgcgtgattttgttgatcgatgcctggaacgagatggtgctatacgagtggcaccgttg
accttgcttgcgcatccgctaatccgtcgagctgagcacatctctaatacagacatggct
cgcttcgttgcgagtgtttggaggtgggactataattga

DBGET integrated database retrieval system