KEGG   Malassezia globosa: MGL_4122Help
Entry
MGL_4122          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mgl  Malassezia globosa
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MGL_4122
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGL_4122
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MGL_4122
Enzymes [BR:mgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MGL_4122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 532 aa AA seqDB search
MKYLSTRGGHERLTFEEAVLQGLAPNGGLYVPAEMPTLPDDWQTAWASLSFVELSFQIVS
LFVPTTAEEGGIPPDDLRELITKSYATFRHEDVTPLRRVSEHEWCLELWHGPTFAFKDVA
LQLLGNLFEYFLARRNATASNANRADRAPHTLTVLGATSGDTGSAAIAGLRSKENIHIFI
LHPRGRVSPIQEAQMTTVLDDNVHNLAVDGTFDDCQDIVKALFSDKAFNDQHHLGAINSI
NWARILSQIVYYFAAFFALRREQPQIDASSVQVVVPTGNFGDILAGYYAKRLGVPMSKLV
VATNENDILQRFWATGRYEKESASGEVRATLSPAMDILVSSNFERLLWYLAHESDTEADD
KEEAAGQQVTQWMHELKTRGSFAVSDAQWELAKRDFLAERVSNDETRSTIRRYFRTKEEP
GSYLVDPHTAVGFEAANRRANGHAVPQIILSTAHPAKFSEAVISSIAADSNEGEAARYFD
THVLPKEMHGLLDKERRVVDVNAAPEAGSNKLQGLIASTKAIIERDGFSSRM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttgagcacgcgtggtgggcatgagcgcctgacgttcgaagaggctgtcttg
caagggctcgcaccgaatggaggattgtatgtgccagctgagatgccaacgcttccagac
gactggcagacggcatgggcgtcgttgagcttcgtcgagctgtccttccagattgtgtct
ttattcgtgccaaccacggccgaagaaggcggtataccgccggatgacctgcgagagctg
atcacaaaatcgtacgcgacgttccgccacgaggacgtgacgccgctgcgccgtgtctcg
gagcacgaatggtgcttggaactgtggcacggaccaacatttgcgttcaaagatgtcgct
ctccagctgcttggaaacttgttcgagtatttcctcgctcgccgaaacgccaccgctagc
aacgccaaccgggctgaccgtgcgccccacacgttgacggtgcttggcgcgacaagtggc
gacacaggcagtgcggcaatcgcaggactgcgctccaaggagaatattcacatatttatc
ctgcatccacgcggccgtgtgtcgccgatccaggaagctcagatgacaaccgtactcgac
gacaatgtccacaatctggccgtcgacggcacattcgacgattgccaagacattgtcaag
gcgctcttttccgacaaggccttcaacgatcaacaccatctcggtgcgattaatagcatc
aattgggcacgcatcttgtcgcagattgtatactatttcgcggccttctttgccctgcgc
cgcgaacagccgcagatcgacgcttcgtccgtgcaggttgttgtgcctacgggcaacttt
ggcgatatcctcgccggatactatgcgaagcgcctgggcgtgccgatgtcgaagcttgtc
gttgcgacgaatgagaatgacatcctgcagcggttctgggcgacgggacgctatgaaaaa
gagtcggcatccggcgaggtgcgcgcaacgcttagtcctgcgatggatattcttgtgtcg
agcaactttgagcgcttgctttggtaccttgcgcacgagtccgacacagaggcggacgac
aaggaagaggccgctgggcagcaagtcacccaatggatgcacgagctcaagacacgcggc
tcattcgccgtctcagacgctcaatgggagcttgccaagcgcgacttccttgcagagcgc
gtgtcgaacgacgagactcgcagcacaattcgccgctacttccgcacgaaggaagagccc
ggatcctatctcgtggacccgcacacagccgtcggcttcgaggctgcgaaccgccgtgct
aacggccatgccgtgcctcaaatcattctatcgacggctcatcccgccaagttttccgag
gctgtcatttcgtccattgccgccgactcgaatgagggcgaagctgcccgctatttcgac
acacacgtccttcccaaggagatgcacggcctcctagacaaggagcgtcgcgttgtcgat
gtgaatgcggcgcctgaggctggctctaacaagctgcagggtctcattgccagtaccaag
gccatcattgagcgtgatggcttcagctcacgtatgtag

DBGET integrated database retrieval system