KEGG   Malassezia globosa: MGL_4133Help
Entry
MGL_4133          CDS       T01043                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
mgl  Malassezia globosa
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MGL_4133
Enzymes [BR:mgl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGL_4133
Peptidases [BR:mgl01002]
 Metallo Peptidases
  Family M67
   MGL_4133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 851 aa AA seqDB search
MKLRRFRAQEASAVPCSAPGTLAEQRMLTSPMNQVSLLARTDTQQPQTQPGAGFFSRTNR
RPASLQELDEQVADLRQELRFSSSVPISHWIRCADVLKRRADQHHHASDLEGQYLCLAKC
EKILAELIPHEHTAWHKLDSKNAVAIHSLVSLTRDALLDARGEARSSASSASSAQYKPPL
SPSALAGTPSRSSFRRNSSTRKRVSFAEESVSSPSMNRTTPRSGWSLRSILPWHRPSLSA
TSSSDKPAPAVVTTLSSRPAGLPLSTPDAWASSAAEPAVPATSTSASGYVAADPKRFSRP
HASHVKHTAQARASASTARPPTQPDTRPASYAALHPAPMPTYPPSVEAGPSRAAAPPPVD
GRPRQDPRRSMSPTDAAVGRRGTTYSTTAQHKPTPVPATVTRRASRTASRAVSPPLSVSP
SPPTLSPSTSRASSPTGFARRSTYLSTSIPSIPQAPIPTSSPPRTSSSAAPIASLSRSPP
SVRRRSSERRFLTSDRPASLVVRPSTSLLGMPASSRAPAGKERLASVADTEQEYERRTPA
RTSTEAVRHRDQDRDYDRDRDRDRDREVHARARAHMPLQRRASKPHGPRPSSVDIRTNLA
GWARLPEVQSSPPLTSLDLFMLPSEELGEVAAQSRTSAASGATAATDGKQARCPTTEAGD
VLRQVVLPGTLPTRFLAHAQANTKAERETCGYLLGHRRFDALCVTHLVIPEQTGTNYSCQ
AYGEEQLLAYQIQHDLLTIGWIHTHPTQTCFLSSLDLHTHSGYQALLPEAVAVVCAPREQ
PSVGVFRLTQPPGLQYILQCKDPEPFHAHADQDATSTPLYTDATHGHVVWKEQAPLTIED
WRSSHPACPSP
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcgccgattccgcgcgcaagaggcatcagccgtaccatgctctgcaccaggg
accctggcagagcagaggatgctgacgtcaccgatgaaccaggtgagccttcttgcgcgg
acggacacgcagcagccacagacgcagccgggagccgggttcttctcacgcaccaaccgg
cggcccgcatcgctgcaagaactggacgaacaggtggctgacttgcggcaggagctgcga
ttctctagctccgtcccaatcagtcactggatccggtgtgcggatgtgctcaagcgtcgg
gctgatcagcatcaccatgcgagtgatctggaaggccaatacctatgtctggccaagtgc
gaaaaaatcctcgctgagctgattccccacgagcatacggcatggcacaaattggacagc
aagaatgccgtggctatccacagtctagtgtcactcactcgagatgccttgctcgatgct
cgcggcgaggcgcggtcgtctgcgtcgtccgcgtcgtccgcccaatacaaacccccgctg
tcgccgtcggccctggctggcacgccgagccgctcgtcattccgccggaactcatccacc
aggaaacgcgtttcattcgcagaagagtccgtctcgtcaccttcaatgaaccgtacgacg
ccgcggtctgggtggtcgttgcgctcgatccttccatggcaccggccgtcgctctcggca
acttcatcgagtgacaagccagcaccagcggtggtaacgacgctctcatcgcggccggct
ggccttcctctgtcgacgcctgatgcttgggcctcgagcgctgcagagcctgcagtaccc
gcaacgtcgacatccgcgtcgggctatgtggcagcggatcccaagcgtttctcacgcccg
cacgcctcgcatgtcaagcacacagcacaggcgagagcgtcagcgtccaccgctcgtcca
cccacgcagccagacactcgaccagcatcgtacgccgcactacatccggcaccgatgccc
acgtacccgccaagtgttgaagcaggaccaagtcgcgctgctgcgccaccaccggttgac
gggcggccacgacaagatccacgccgatccatgtcgcccaccgatgcggccgttggcaga
cgcggcactacgtactctacgacagcgcagcacaagccgacaccggtcccggccacagtg
acgcgacgcgcttcgcgcaccgcctcgcgagccgtgtcgccgccgctctcagtttcccca
tcgccgcccactctgtcgccgtcgacgagtcgtgcatcgtctcccacgggctttgccagg
cgatcaacatacctttccacctctataccttcgatacctcaggcgcctataccaacatcc
tcaccgccgcgtacatcatcatctgccgcgcctatcgcgagtctctctcgctcgccaccg
tcggtgcggcgccgatctagtgagcgccgctttcttacatctgaccgacccgcgtcgctc
gtcgttcgtccttccacatcattgctaggcatgccagcgtcgtcccgtgcaccggcagga
aaagaacgcttggcgtccgtggccgataccgagcaggagtatgagcggcgaactcctgcg
cgtacgagtaccgaggctgtacgacatcgagatcaagatcgtgattatgatcgcgatcgc
gaccgcgaccgcgaccgcgaagtgcatgcgcgcgcgcgcgcgcatatgccgctacagcgc
cgcgcatcgaaaccacacgggccgcgcccatcgtccgtggatatccgcacaaatctggca
ggctgggcacgcttgccagaagtgcagagctcaccaccattgacgagcttggatctgttt
atgctgccgagcgaggagctcggcgaagttgctgcgcagtcccgcacatccgctgctagt
ggtgctacggctgctacggacggcaaacaggcacggtgtcctacgacagaggctggcgac
gtactgcggcaagttgtgctgcctggcacgctcccgacgcgcttccttgcacatgcacag
gcgaataccaaagcagagcgcgagacgtgtggctatttgctgggccatcggaggttcgac
gctttgtgtgtgacacatcttgtcattcccgagcagaccggcaccaactacagctgccag
gcatatggcgaagaacagctgctcgcataccagatccagcacgatttgctcactataggc
tggatccacacgcatccaacacagacgtgcttcctgtcgtcgctcgacttgcacactcat
tctggctaccaggcgctcctgcccgaggccgttgccgtcgtctgtgcgccacgtgagcag
ccgagtgtgggtgtgttccgactcacccagccgccgggcctgcagtacatactacaatgc
aaggatccggagccgttccatgcgcacgcggatcaggacgccacgtcaacgcccttgtac
acggatgcgacgcatgggcatgtggtgtggaaggagcaggcgcctctgacgatcgaagac
tggcgctcttcacaccccgcatgcccgtcgccatga

DBGET integrated database retrieval system