KEGG   Magnetococcus marinus MC-1: Mmc1_0041Help
Entry
Mmc1_0041         CDS       T00427                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mgm  Magnetococcus marinus MC-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(43642..44085)
Genome map
AA seq 147 aa AA seqDB search
MRNCQQALLMLDKQPHVTVTACSSWYRTEPLGPQQPDYINGAATLTTTLSPLALLALLLD
VEQQMGRDRHREQRWGPRALDLDLLFYADLLLDHPQLILPHPQLHLRRFVLQPLGEIIPT
KRHPKLGKTVDTLLSEVEDRGQVERLS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaactgccagcaggccctgcttatgctggacaagcagccccatgtcacggtgaca
gcctgctcatcctggtatcgtaccgagcccttgggaccacaacagcccgactatatcaac
ggcgcggccaccctgaccaccaccctgtcccccttggcgttgctggcgctcttgttggat
gttgagcaacagatgggacgagaccgccaccgggaacagcgctggggacccagagcgctg
gatctggatctgctcttttatgcggacctgctgttggatcaccctcagcttatcttgccc
cacccccagttgcacctacgccgttttgtgttgcagccgcttggggagattatccccacc
aagcgacaccccaaactgggcaaaaccgttgacaccctcttgagtgaggttgaagatagg
ggccaagtggagcgcctgagctaa

DBGET integrated database retrieval system