KEGG   Magnetococcus marinus: Mmc1_0046Help
Entry
Mmc1_0046         CDS       T00427                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00300  Lysine biosynthesis
mgm01100  Metabolic pathways
mgm01120  Microbial metabolism in diverse environments
mgm01230  Biosynthesis of amino acids
Module
mgm_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mmc1_0046
Enzymes [BR:mgm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mmc1_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABK42575
JGI: Mmc10046
UniProt: A0L3N2
Position
48503..49666
Genome map
AA seq 387 aa AA seqDB search
MTVYSPEMVDPVALARALIQAPSVTPMDHGCQDLLIRHLEDLGFTVHRLRFGHVENFYAR
LGSKGRNFTFAGHTDVVGAGDTSRWSSDPFAATLEEGYITGRGAVDMKGGLACMVAATAR
FLAARPHFAQQHSLSFLITGDEEGDALDGTLKVLQWLESQQEKMDYCLVGEPTSAAQLGD
CIKNGRRGSVNGRLTIRGVQGHVAYPHLVDNPIHRAAPVLAAISSMTFDQGDRFFQPTSL
QFTAVQSGGSATNVVPGELTAGFNIRFSAMHTPESLEARIRQVLDGAEVDYDLQMMTSGL
PFITEGGPLVEAVKATVAQVTGLEPQLSTGGGTSDARFISRHCVQTVEFGLVGSTMHKVD
ERVPVADLEVLTEVYRRLLERLYPPQG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacggtttattcacccgaaatggtggatccggtggcactggcgcgggccttaattcag
gccccgtcagtgacgccaatggatcatggctgccaagatctgctgattcgccatctggag
gatctgggttttacggtgcatcgactgcgttttggtcatgtggagaacttttacgcgcgg
ctgggcagcaaggggcgcaattttacctttgccggacataccgatgtggtgggggcaggg
gataccagccgctggtccagtgacccctttgcagcgaccctggaagagggctatatcacg
ggccgtggggcggtggatatgaagggtggcttggcctgtatggtcgccgcgaccgcgcgt
tttttggcggcgcgtccccattttgcgcagcagcatagcctaagttttctcattaccggt
gatgaagagggggatgcgctggatggcaccctcaaggtgttacagtggttggagagccag
caggagaagatggattactgcttggtgggggagcccaccagtgcggcacagttgggggat
tgcatcaagaatgggcggcgtggttcggtgaacggtcgtttgaccattcgcggggtgcag
gggcatgtggcgtatccccatttggtggataatcccattcaccgggccgccccggtgctg
gcggcgattagcagcatgacgtttgaccaaggggatcggttttttcagccgacttctctt
cagtttacggcggtgcagtcgggtggtagtgccaccaacgtggtgccgggtgagctgacg
gcggggtttaatatccgctttagtgccatgcacacccccgagagcttggaggcccgcata
cgccaagtgttggatggggccgaggtcgattatgatctacagatgatgacctcgggactg
ccctttattaccgagggtgggcctctggtggaggcggtcaaggcaacggtggcgcaggtc
acagggttggagccgcagctctccaccggcgggggcacctcggacgcccgttttatctcc
cgccattgtgtgcagacggtggagtttggtctggtgggcagtaccatgcacaaagtggat
gagcgggtgccggtggcggatttagaggtgttgaccgaggtataccggcggctgttggag
cggctctaccccccccaggggtga

DBGET integrated database retrieval system