KEGG   Magnetococcus marinus: Mmc1_0103Help
Entry
Mmc1_0103         CDS       T00427                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00240  Pyrimidine metabolism
mgm00250  Alanine, aspartate and glutamate metabolism
mgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mmc1_0103
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmc1_0103
Enzymes [BR:mgm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mmc1_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABK42632
JGI: Mmc10103
UniProt: A0L3T9
Position
complement(107792..108781)
Genome map
AA seq 329 aa AA seqDB search
MDPEQNAWTRRHMLGMDGLARHEIGAILDSAQAFRDVNYREIKKVPTLRGKTVINLFYEN
STRTRTSFELAGKRMSADVINISASSSSAAKGETLLDTVATLQAMRPDVVVLRHGDSGAP
HFLARHLDAGIINAGDGQHEHPTQSLLDLLTIQDHLEEMGKSSFEGMNVAICGDVLHSRV
ARSNAFALRTLGANVRFVGPPTLMPSEATKVFGVTVHHNMEEGLRGVDVIIMLRLQLERM
TSAYLPSVREYFAYWGLTRGRLELTQPHALVMHPGPINRGVEIASDVADNPNRSVILEQV
ANGLAVRMAVLYHLCTGAARNSAQLGESL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggacccggaacagaacgcctggacccgccgccatatgcttggcatggatggtttggcc
cgtcacgaaatcggtgccattttggattctgcccaggcttttcgcgatgtcaattatcgt
gagatcaaaaaggtccccaccctgcgtggcaagaccgtgatcaatctcttttacgaaaac
tccacccgcacccgtacctcttttgaactggccggtaaacgcatgagcgccgatgtgatc
aacatctccgcttccagtagctccgccgccaaaggggagaccctgctcgataccgtggcc
accctacaggccatgcgtcccgatgtggtggtgctgcgtcatggggattctggtgccccc
cactttttggcccgccatctggatgccggtatcatcaacgccggtgatggtcagcacgag
caccccacccaatcactgctggatctgctcaccattcaagaccacctggaagagatgggc
aaaagcagctttgaagggatgaacgttgccatctgtggcgatgtcctacatagccgggtg
gcccgctccaacgcctttgccttgcgcaccctgggtgccaatgtgcgttttgttggcccc
ccaacccttatgccctctgaagcgaccaaggtgtttggcgttacggtccaccataatatg
gaagaggggctgcggggggtggatgtgatcattatgctgcgtctgcaactggaacgcatg
acctcggcctatctgcccagtgtacgcgaatatttcgcttattggggcctgacccgtggt
cgcttggagctcacccagccccacgccctggtgatgcatcctggccccatcaaccggggt
gtggagattgcctcggatgtggcggacaatcccaaccgttcggttattttggagcaggtt
gccaacggtttggcggtgcgtatggcggtgctttaccatctttgcaccggtgccgcccgt
aactcagcgcagctaggagagtcgctatga

DBGET integrated database retrieval system