KEGG   Magnetococcus marinus: Mmc1_0330Help
Entry
Mmc1_0330         CDS       T00427                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00790  Folate biosynthesis
mgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmc1_0330
Enzymes [BR:mgm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Mmc1_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ABK42856
JGI: Mmc10330
UniProt: A0L4G3
Position
380144..380692
Genome map
AA seq 182 aa AA seqDB search
MVPCDGPVLVAFGASLNPLYHLELGLRRLHALLGIVAISDVYQSRPVNGAVGDPPFLNGA
VRLEQAPEPWALRALLRQIEAEQGRERGDNPNAPRTLDLDIALMGSQIMDEPLLRIPDPH
WLARPFVALPMAQLAAAWRHPEHPYSLAQLAARFDPLPVGMHKDLEATRRLRQILPPFPN
TV
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggtcccatgcgatggacctgtgctggtggcctttggggccagccttaacccgctgtat
catctggagttgggcttgcgacgcttgcacgcgctgttgggcattgtcgccatttccgat
gtctaccaaagcagacccgtgaatggggctgtgggggaccccccttttcttaatggcgcg
gtacgcttggaacaggccccagagccttgggcactgcgcgccttgctgcgccagatcgag
gctgaacaggggcgcgaacggggcgacaatcccaatgcgccgcgcaccttggatctggac
atcgccctgatgggtagccaaatcatggatgaacccctgttacgcatccctgacccccat
tggttggcgcggccctttgttgccctacccatggcccagttggccgcagcgtggcgccat
cctgagcatccttattcgttggctcaattagcggctcggtttgatcccttacccgttggc
atgcacaaagatcttgaggcaacgcgacgtttgcgccagattttaccccctttccctaac
actgtgtag

DBGET integrated database retrieval system