KEGG   Magnetococcus marinus: Mmc1_0335Help
Entry
Mmc1_0335         CDS       T00427                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mgm  Magnetococcus marinus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmc1_0335
   00052 Galactose metabolism
    Mmc1_0335
   00500 Starch and sucrose metabolism
    Mmc1_0335
   00520 Amino sugar and nucleotide sugar metabolism
    Mmc1_0335
Enzymes [BR:mgm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mmc1_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(387132..388013)
Genome map
AA seq 293 aa AA seqDB search
MMKVRKAVFPVAGLGTRFLPATKVVPKEMLSVVDTPLIQYAVEEAWDAGIEEVILITGRG
KSLLMDQFDHMYELEDTLRRQGKEVLLSVSHEPIPFPGTVVATRQQDPLGLGHAVWCARY
LVGDEPFAVILPDDLVHAQKPVLKQMVERFEELQSSIVAVMEVAPDQTNKYGILDSEPEQ
NGVWRIKGLVEKPDPSVSPSNLAIIGRYILTPEIFCLLESIPRGAGGEIQLTDAMAALLK
HQSIYGMRFEGTRFDCGDKAGFQMASLALSMERPELKDQMLAFIQENLPKWQA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggttcgtaaggccgttttccccgtagcaggcttaggtactcggtttctaccc
gccaccaaggtggtcccaaaagagatgctctcggtggtggatacgcccctgattcaatat
gccgtggaagaggcctgggatgcaggtattgaagaggtcattctcattacaggacgtggc
aaaagcctgttaatggaccagtttgaccacatgtatgagctggaagataccctgcgccgc
caaggcaaagaggtgttgctcagcgtttctcacgaacccattccgtttcccggtacggtg
gtcgccacccgccagcaagatcccttgggattgggccatgccgtatggtgcgcccgctat
ctggtgggggatgaaccctttgccgttatcctgcccgacgatctggtacatgcccaaaaa
ccggtgctcaagcagatggtagaacgctttgaggagctgcaatccagtatcgtagcggtc
atggaggtcgccccagaccagaccaacaaatatggtattctggacagcgaaccagaacaa
aatggggtgtggcgcattaaggggttggtggagaaaccggatccgtccgtgtcaccctcc
aatttagccatcattgggcgctatattctcaccccagaaatcttctgtctgctggaatcc
attcctcgtggtgcaggtggtgagattcagttgaccgatgccatggcagccttactcaaa
catcaatccatctacggcatgcgctttgagggcacccgtttcgattgtggtgataaagca
ggttttcaaatggcttcattggcactcagcatggaacgcccagagttgaaagatcaaatg
ctggcctttattcaggaaaatctgcccaaatggcaagcttaa

DBGET integrated database retrieval system