KEGG   Magnetococcus marinus: Mmc1_0337Help
Entry
Mmc1_0337         CDS       T00427                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mgm  Magnetococcus marinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmc1_0337
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmc1_0337
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmc1_0337
Enzymes [BR:mgm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmc1_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
389056..390300
Genome map
AA seq 414 aa AA seqDB search
MSKGYFGAFGGAYIPEILHETFAQLTLAYETARADEAFWRHYIELMRNYSGRPTPLTFAE
NLSLAHGKRRIYIKREDLNQTGAHKANNVMGQGLLVRRMGKTRVIAETGAGQHGVATATM
AARLGLACTIYMGAKDVARQRPNVFWMEQLGATVIPVTSGSQTLKDAVNEAMRDWVGSMD
NTHYVLGTACGAHPFPEMVSWFQSVIGQEARVQILEQEGRLPDHVYACVGGGSNAMGIFQ
GFLEDPQVELIGVEAGGLGLAGHNHASRIASGKSTVGIAQGYKTCFLQDEDGQMRDTHSV
AAGLDYVGVSPILADLHQQGRVRFEAATDVEVVEALKRMVKSEGIIPALESSHAVAGALR
ELPQLKEDAVVIINLSGRGDKDIFTIAEALGDAKWKTYIQERAAIYAAEQGERS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagggttactttggcgccttcggcggcgcatatattcctgagattttgcacgaa
acctttgcccagttgaccctggcctacgaaaccgcccgcgcggatgaggcgttttggcga
cactatattgagcttatgcgcaactactcgggccgtccaacccccttgacctttgcggaa
aacctctccctggcccacggcaaacggcgcatctatatcaagcgggaggatcttaaccag
accggtgcccacaaggccaacaatgtcatggggcaggggctattggtgcgtcgcatgggc
aaaacccgtgttattgctgaaaccggtgctggtcagcatggggtggcgaccgccaccatg
gcggcacggttgggtttggcttgtaccatctatatgggggccaaagatgtggcccgtcag
cgccccaatgtgttttggatggagcagctgggggccaccgtcatccccgttacatcgggt
tcgcagacccttaaagatgcggttaacgaggcgatgcgtgattgggttggcagtatggat
aacacccactatgtgctgggcacggcgtgtggggcgcatccttttccagagatggtctct
tggtttcagtcggtcattgggcaagaggccagggtgcagattttggaacaggaggggcgt
ctgccagaccatgtctatgcctgtgtgggcgggggttctaatgccatgggtattttccag
ggctttcttgaggatccccaggttgagctgattggggtggaggccggaggtttgggtttg
gccggccataaccacgcttcgcgcattgcctcgggcaagagcacagtgggcattgcgcaa
gggtataagacctgctttctacaggatgaagatggtcagatgcgtgatacccactcggtg
gcggcgggtctggactatgtaggggtgtcgcccattttggccgatctgcaccagcaaggg
cgggtacgctttgaggcggcgaccgatgtggaggtggtggaggcactcaagcgcatggtc
aaatctgagggtattattccggcgttggagtcgagccatgcggtggccggtgccctgcgt
gagctgccccaacttaaagaggatgcggtggtgattatcaatctttccgggcggggcgat
aaggatattttcaccattgctgaggcgctgggcgatgccaaatggaagacctacattcag
gagcgagccgccatctacgcagcggaacagggagagcggtcatga

DBGET integrated database retrieval system