KEGG   Magnetococcus marinus: Mmc1_0338Help
Entry
Mmc1_0338         CDS       T00427                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mgm  Magnetococcus marinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmc1_0338
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmc1_0338
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmc1_0338
Enzymes [BR:mgm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmc1_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
390297..391076
Genome map
AA seq 259 aa AA seqDB search
MSRKSALEGHIKDKLQQQDILLMSHIVLGYPSLQANREVIRAMVAGGVDLMELQIPFSEP
IADGPTIARANQAALDGGFKVREGLAFIREVVAAFNIPFLIMTYTNILMAYGVERFIDEV
ADIGVKGLIIPDLPLEQAQAAIEQCRAKGMDWIGLMTPTSVDERLGKIGAAADGFVYCVA
RRGVTGSKTSFDEHVGAFMHRCRQATPVPLAVGFGVRSAEDVDYLKGKAEIAVVGSAALD
LFDQAGAAALEPFFRGLRG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaaaagcgccctggagggccacattaaagataaattgcagcagcaggatatt
ctgctgatgtcccatattgtgttgggctacccctctttacaggccaaccgagaggtgatc
cgtgccatggtggcggggggggtggatctcatggagttgcagattcccttttccgagccc
atcgccgatggtcccaccatcgcgcgggccaaccaagcggccctggatggggggtttaag
gtgcgcgaggggttggcctttattcgtgaggtggtggccgcgtttaatattccgttcttg
attatgacctataccaacattctcatggcctatggtgtggagcgttttattgatgaggtg
gcggacatcggggttaaagggttgattattcccgatctgcctttggagcaggcacaggca
gccattgaacagtgccgggccaagggtatggattggatcgggttaatgacccccaccagc
gtggatgagcggttaggcaagattggcgcggcggcggatggttttgtctattgtgtcgcc
cgccggggtgtgaccggtagcaagacctcctttgatgagcatgtgggtgcctttatgcat
cgctgtcggcaggctacccctgtacctttggcggtgggttttggggtgcgcagtgccgag
gatgtggactatctcaagggtaaagcagagattgctgtggtgggcagtgcggcgctggat
ctgtttgaccaagcgggggcagcggcgctagagcccttttttcgcggcttgcggggttag

DBGET integrated database retrieval system