KEGG   Magnetococcus marinus: Mmc1_0439Help
Entry
Mmc1_0439         CDS       T00427                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00790  Folate biosynthesis
mgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmc1_0439
Enzymes [BR:mgm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mmc1_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CAT_RBD
Motif
Other DBs
NCBI-ProteinID: ABK42964
JGI: Mmc10439
UniProt: A0L4S1
Position
526804..527961
Genome map
AA seq 385 aa AA seqDB search
MTHYAVVTPTMGAAGAHFFAAPRMGDGVAPFPAMPELPMAVRLFPWPEAWDGLLPEGMEI
YLSGTLRMARGWLLPSVLERWQERIFQTVAQDSAMALHQSLRNLNTPRAAMSYLDAQGKR
RKLAGDRPLIMGIVNVTPDSFSDGGHYHDTGRAVAHAMALVEQGADLLDIGGESTRPGAA
MVPVDEELRRVVPVVRAIAAQTKVPISVDTAKGRVMEAALEAGAALINDVTALKGDPLSL
RVLRDAHCPVVLMHKKGTPRNMQNSPHYEDVVAEVYGFLGDRMQWCVENGIGRERLVIDP
GIGFGKTHGHNLELLAHIGAFTGLAAPLLLGISRKRIVGHLTGCEDAAQRDVGSHLMAAL
GVQRGANWVRVHDVAGMQQALRCLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattatgccgtagtaacaccgaccatgggcgccgcaggcgcccatttttttgca
gcaccccgcatgggcgatggggtggcacccttcccggctatgcccgaactgcccatggcg
gtacggctctttccctggcctgaggcgtgggatgggctgttgccagagggtatggagatt
tatctcagtggcaccttgcgcatggcccgtgggtggctgttacccagcgttttagagcgt
tggcaagaacgcatttttcagaccgtggctcaggatagcgccatggcgttgcaccaatcc
ctgcgcaacctaaacacgccccgcgcggccatgagctacttggatgcacaaggcaaacgg
cggaaattggccggggatcgtcccctgatcatgggtattgtcaatgtaacccccgactcc
ttctcggatggtggccactaccatgataccggcagggctgtggcgcatgccatggcgctg
gtcgaacaaggggcagatctgttagacattggtggggaatccacccgccctggtgcggcc
atggtgcccgtggatgaggagttgcgtcgcgtagtaccggtggtgcgggccattgccgcc
cagacaaaggtgcccatttcggtagatacggcgaagggtcgggtgatggaagcggcctta
gaggctggggcagcccttattaatgatgtcaccgcactcaaaggggatcccctgtcgctt
cgagtattacgggatgcccactgccctgtggtgctcatgcataaaaagggcacacctaga
aacatgcagaatagcccccactatgaggatgtggtggctgaggtgtatggttttctgggt
gaccgtatgcagtggtgtgtggaaaatggtattgggcgggagcggctggtgattgatcca
ggtatcggttttggtaaaacacatgggcacaatctggagctgttggcccatattggtgcc
tttacgggtttggccgcgcctctgttgctggggatttcacgcaaacgtattgtgggccat
ttaacagggtgtgaagatgccgcacagcgtgatgttggcagccatcttatggccgctttg
ggggtgcagcggggggccaattgggtaagggtacacgatgtggcgggtatgcaacaggcg
ttgcgttgtctggtatga

DBGET integrated database retrieval system