KEGG   Magnetococcus marinus MC-1: Mmc1_0439Help
Entry
Mmc1_0439         CDS       T00427                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mgm  Magnetococcus marinus MC-1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
526804..527961
Genome map
AA seq 385 aa AA seqDB search
MTHYAVVTPTMGAAGAHFFAAPRMGDGVAPFPAMPELPMAVRLFPWPEAWDGLLPEGMEI
YLSGTLRMARGWLLPSVLERWQERIFQTVAQDSAMALHQSLRNLNTPRAAMSYLDAQGKR
RKLAGDRPLIMGIVNVTPDSFSDGGHYHDTGRAVAHAMALVEQGADLLDIGGESTRPGAA
MVPVDEELRRVVPVVRAIAAQTKVPISVDTAKGRVMEAALEAGAALINDVTALKGDPLSL
RVLRDAHCPVVLMHKKGTPRNMQNSPHYEDVVAEVYGFLGDRMQWCVENGIGRERLVIDP
GIGFGKTHGHNLELLAHIGAFTGLAAPLLLGISRKRIVGHLTGCEDAAQRDVGSHLMAAL
GVQRGANWVRVHDVAGMQQALRCLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattatgccgtagtaacaccgaccatgggcgccgcaggcgcccatttttttgca
gcaccccgcatgggcgatggggtggcacccttcccggctatgcccgaactgcccatggcg
gtacggctctttccctggcctgaggcgtgggatgggctgttgccagagggtatggagatt
tatctcagtggcaccttgcgcatggcccgtgggtggctgttacccagcgttttagagcgt
tggcaagaacgcatttttcagaccgtggctcaggatagcgccatggcgttgcaccaatcc
ctgcgcaacctaaacacgccccgcgcggccatgagctacttggatgcacaaggcaaacgg
cggaaattggccggggatcgtcccctgatcatgggtattgtcaatgtaacccccgactcc
ttctcggatggtggccactaccatgataccggcagggctgtggcgcatgccatggcgctg
gtcgaacaaggggcagatctgttagacattggtggggaatccacccgccctggtgcggcc
atggtgcccgtggatgaggagttgcgtcgcgtagtaccggtggtgcgggccattgccgcc
cagacaaaggtgcccatttcggtagatacggcgaagggtcgggtgatggaagcggcctta
gaggctggggcagcccttattaatgatgtcaccgcactcaaaggggatcccctgtcgctt
cgagtattacgggatgcccactgccctgtggtgctcatgcataaaaagggcacacctaga
aacatgcagaatagcccccactatgaggatgtggtggctgaggtgtatggttttctgggt
gaccgtatgcagtggtgtgtggaaaatggtattgggcgggagcggctggtgattgatcca
ggtatcggttttggtaaaacacatgggcacaatctggagctgttggcccatattggtgcc
tttacgggtttggccgcgcctctgttgctggggatttcacgcaaacgtattgtgggccat
ttaacagggtgtgaagatgccgcacagcgtgatgttggcagccatcttatggccgctttg
ggggtgcagcggggggccaattgggtaagggtacacgatgtggcgggtatgcaacaggcg
ttgcgttgtctggtatga

DBGET integrated database retrieval system