KEGG   Magnetococcus marinus: Mmc1_0459Help
Entry
Mmc1_0459         CDS       T00427                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mgm  Magnetococcus marinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmc1_0459
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmc1_0459
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mmc1_0459
Enzymes [BR:mgm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mmc1_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
549105..550484
Genome map
AA seq 459 aa AA seqDB search
MRYISTRGGVAPLSFSEAVMMGLATDGGLLVPERLPQVDGATLRRWAKLSYQELALEVMR
PFVEEDIPEADLRPLVINAYAKFEHDEITPLVKVGDVQILELFHGPTLAFKDVALQFLGN
LFEYLLEKQGGRLNIIGATSGDTGSAAIHGVRGKSGIDIFILHPHQRVSPVQERQMTTVL
DDNVHNIAIEGNFDDGQAIVKALFNDLAFKEKYHLGAVNSINWARILAQIVYYFRGWARA
TGGNPEQKVSFSVPTGNFGDIYAGYLARQMGLPVDRLILATNRNDILSRFVLHGSYSKGV
VEPTISPSMDIQISSNFERYLFDLLERDGDGVKGCMAELAEQGGFSVSAEKLAQVRTIFD
AVAVSEAQTLETITRVHRESGYVLDPHTAVGVAAAAGRQGVICLATAHPAKFADAVRQAT
GEAVALPPSMQDLMTLPTRCEVLPATAAAIKAKVEQTLA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttatatcagtacccggggcggtgtggcccctctctcgttttctgaagcggtgatg
atgggtttggccacggatgggggtctgttggtgccggagcggctgccccaggtggatggc
gcaaccctgcggcggtgggccaagctctcctaccaagagttggccctagaggtgatgcgc
ccctttgtggaggaggatattcccgaggccgatctccgccccttggtgatcaacgcttac
gccaagtttgagcatgatgagattacccccctggtcaaggtgggggatgtgcagatattg
gagctgtttcacggccctaccttggcgtttaaggatgtggcgttacagtttttgggcaat
ctgtttgagtatctgttggaaaagcaggggggacgcctgaacattattggcgcaacctcg
ggggataccggttcggcggcgatccatggggtacggggtaagagtggcattgacatcttt
attctgcatccccaccaacgggtatcgccggtgcaggagcggcagatgaccacggtgttg
gacgacaatgtacacaacatcgccatagagggtaattttgatgatggtcaggccatcgtt
aaagcgctgtttaatgatcttgcgtttaaggaaaagtaccatttaggggcggttaactcc
attaactgggcgcgaattttggcgcagattgtctactatttccggggttgggcgcgagcc
acgggtgggaatccagagcagaaggtcagtttttcggtgccaacgggtaattttggtgac
atctacgccggttatctggcgcgacagatgggcttgccggtggatcgattgattttggcc
accaaccgcaacgatattttaagccgctttgtgttgcacggcagctacagcaagggtgtg
gtggagcccaccatcagcccctccatggatattcagatctcttcgaactttgagcgctat
ctgtttgatctgctggagcgtgatggggatggggtaaaggggtgcatggcggagctggcc
gagcagggtggattttcggtttctgcggaaaagctggcgcaggtgcgcaccatttttgac
gctgtcgcggtgagcgaggcgcaaacattagagaccattacccgcgtgcatcgggagagt
ggttatgtgttggacccccacactgcggttggggtggcagcggcggccggtaggcagggt
gtgatctgtctggccacggcgcatccggccaagtttgccgatgccgtacggcaggctacg
ggtgaggcggtggctttaccaccctctatgcaggatttaatgaccctaccgacccgttgt
gaggttttacccgccaccgccgcagcgatcaaagccaaggttgaacagaccctcgcctag

DBGET integrated database retrieval system