KEGG   Magnetococcus marinus: Mmc1_0477Help
Entry
Mmc1_0477         CDS       T00427                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mgm  Magnetococcus marinus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmc1_0477
Enzymes [BR:mgm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mmc1_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(576260..576874)
Genome map
AA seq 204 aa AA seqDB search
MIAQLKGSLAAKHPDHVVMDVHGVGYRVFISLATYNELPTVGEACLLYTVTHVREDAFLL
YGFHSESQRKVFNLLTSVNGIGTKLALAALSSHTPEALLTALSREDLTLLCTIPGVGKKT
AQRMAMELKDKLGALPMAAPTTAIGAATMAANPAGLREEVASALLNLGYKPPQVDAALAK
LFSAGEITDISVALKGALKLLAPA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattgcccaacttaaaggttcattagcggccaaacatcccgaccatgtggtgatggat
gtgcatggggtgggctaccgggtgtttatctctctggccacctataatgagttgcctacc
gttggggaagcttgtctgctttacaccgtgacccatgtgcgggaagatgcctttttactc
tatggttttcatagtgaatcccagcgcaaggtgtttaatttactcaccagtgtgaatggg
attggcaccaagctcgccttggcggctctctctagccacacccccgaagccctgcttacc
gccctttcccgtgaagatcttaccctgctctgcaccatacccggcgtaggcaaaaagacc
gcgcaacgcatggcgatggagctcaaagacaagctgggtgcgctacccatggcggcccct
accacggccattggtgcagccaccatggcagccaacccggcgggtctgcgcgaagaggtt
gcctcggccctgcttaacttgggctataaaccccctcaagtggatgcggccttggccaag
ctgtttagtgccggggagattaccgacatctccgtcgccctcaagggcgcccttaaactg
ctggctccagcttga

DBGET integrated database retrieval system