KEGG   Magnetococcus marinus MC-1: Mmc1_0598Help
Entry
Mmc1_0598         CDS       T00427                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mgm  Magnetococcus marinus MC-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mgm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgm00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mgm00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mgm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(721340..723274)
Genome map
AA seq 644 aa AA seqDB search
MSDVKVYPVDPNVAANALINEEQYQEMYKRSIDDPAAFWAEQAEARIDWFKKWDNVLDFD
LRKGHIKWFEGAKLNVSYNCIDRHLEKRGDKVAILWEGDNPAADRKITYRELSALVNKFA
NALKARGVKKGDRVCIYMPMIPEAAVAMLACTRIGAVHSIVFGGFSPDALRDRIIDAECR
VVITADGGMRGSKKIPLRKNVETALAQCPNVHTCFVVQDTQLEIEWTEGRDVWYHEAIAA
ASADCPPEEMDAEDPLFVLYTSGSTGKPKGVLHTTGGYLLYASITHQYIFDYHEDDIYWC
TADVGWVTGHTYIVYGPLANGATTLMFEGVPTYPDASRFWQVVDKHQVSIFYTAPTAIRS
IMSQGDALVKATSRQSLRILGSVGEPINPEAWEWYYHVVGEGRCPIVDTWWQTETGGILI
TPLPGATPLKPGSATRPFFGVNPKVLSNEGKEMEGPCEGILVLDHPWPGMMRTVYGDHDR
FINTYFANYPGYYFCGDGCRRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVLHDQVA
EAAVVGMPHEIKGQGIYAYVTLMSGVEPSDALKTELVKLVRKEIGPIASLDVIQFAPGLP
KTRSGKIMRRILRKIAAHEVDTLGDTSTLADPSVVQNLIDNMPK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgttaaagtctaccccgttgatcccaatgttgcggccaacgcgctgatcaac
gaggaacagtaccaagaaatgtataaacgttccatcgacgacccggcggccttttgggct
gaacaggccgaggcgcgcattgattggtttaaaaaatgggacaacgttctggattttgat
ctgcgtaaaggtcatatcaaatggtttgagggggccaaactcaacgtctcctacaactgt
attgaccgccacctggaaaaacgcggggataaagtggccatcctctgggaaggggataat
cccgctgccgaccgtaaaatcacctaccgtgaactctctgcgttggtcaataagtttgcc
aacgctttaaaagcacggggcgttaaaaaaggggatcgggtttgcatctacatgcccatg
attcccgaagccgctgtggccatgctcgcttgtacccgcattggcgcggtgcactccatc
gtctttgggggtttctctcccgatgcactgcgggaccgcattattgatgccgagtgtcgc
gtggtgatcaccgccgatggcggcatgcgtggttctaaaaagatccccctgcgtaaaaat
gtcgagaccgcgctggcccagtgccccaacgtacacacctgttttgtggtgcaagatacc
caattagagattgagtggaccgaagggcgcgatgtttggtatcacgaagccattgcagcc
gccagtgccgactgcccccccgaggagatggatgccgaagatccgctgtttgtgctctac
acctcgggctccaccggcaagcccaagggggttctgcacaccaccggtggttatctgctg
tatgcctctatcacccaccaatatatcttcgattatcatgaggatgacatctactggtgt
accgcagacgtaggctgggtaacgggccacacctacattgtttatggacccttagccaat
ggggccaccaccttgatgttcgaaggggtgcccacctacccggacgcttcccgcttttgg
caggtggtggataaacatcaggtgagcattttctacaccgctcccaccgccattcgctcc
atcatgagccagggggacgcactggttaaggccacctcgcgtcaatcgctgcgcatcctt
ggcagcgtgggtgagcccatcaaccccgaggcgtgggagtggtactaccatgtagtgggt
gaagggcgctgccccattgtggacacttggtggcagaccgaaaccgggggaattttgatt
accccactgcctggggcaacccccttaaaacccggttcagcaacccgtcccttctttggg
gtcaaccccaaagtgctctccaacgagggcaaagagatggagggcccctgtgaaggcatc
ctggttttggatcatccctggccgggcatgatgcgtaccgtgtatggcgaccatgatcgt
tttatcaacacctattttgccaactatcccggctactatttctgtggggatggctgccgc
cgtgatgaagatggctactattggatcacggggcgggtggatgatgtgatcaacgtctcc
ggccaccgtttgggtaccgctgaagtagagagcgccttggtgctgcacgatcaagttgcc
gaagcggcggtggtgggcatgccccatgagatcaagggtcagggcatctacgcctatgtg
acccttatgagcggggttgagccctctgacgcactcaaaaccgagttggtcaagctggtc
cgcaaggagattggccccattgcctcattggatgtgatccagtttgcccccggcctgccc
aagacccgttccggcaagatcatgcgccgcattctccgcaagattgctgcccatgaagtg
gacaccctaggggatacctcaaccctggccgatccatcggtggtgcaaaacctcatcgac
aacatgcccaaatag

DBGET integrated database retrieval system