KEGG   Magnetococcus marinus: Mmc1_0736Help
Entry
Mmc1_0736         CDS       T00427                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00860  Porphyrin and chlorophyll metabolism
mgm01100  Metabolic pathways
mgm01110  Biosynthesis of secondary metabolites
mgm01120  Microbial metabolism in diverse environments
Module
mgm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mmc1_0736
Enzymes [BR:mgm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mmc1_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABK43257
JGI: Mmc10736
UniProt: A0L5L4
Position
complement(909952..910731)
Genome map
AA seq 259 aa AA seqDB search
MATPALHQRTILVTRPQPEADATALLILQAGGTPIITPMLNIAPAEDSQPLQQAIAAIHS
FDGVLITSANAARAYLDALAAQAQPLSGTPPCFAVGPKTAELLRAGGATVCQPSSRFDGE
ALAEAINQWQGKGRHFLFPRAAIGRETLIDGLENDDHRVTMVAAYRALPAQQLSAQAHRY
LREKRVDAALFFSSRTATTFFELLISQALEPAEMVLAALSPVTAERMASLGFAAHVIAPQ
ATAESLLQALADHWNRPTL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacctgcactgcaccagcgcaccatcctggtaacccgccctcaacccgaggca
gatgccaccgccctgttgattctccaagcagggggcacccccatcatcacccctatgctg
aatatcgcacctgccgaggatagccagcctttgcagcaagccatagcggccatccacagc
tttgatggtgtactcatcaccagtgccaatgcggcccgcgcctatctggatgccttggcc
gcccaagcacaacccctctctggcaccccaccctgttttgccgttggccccaagacggcg
gaactgctgcgggcgggcggggcaacggtctgtcaacccagcagccgctttgatggcgaa
gccttggccgaggcgattaatcaatggcagggcaaggggcgccattttctctttccccgt
gccgctattggtcgtgaaacgttgattgatgggctggaaaacgacgaccaccgcgtcacc
atggttgccgcctaccgggcgctaccggcccaacagttgagtgcgcaagcgcaccgctac
ttgcgtgaaaaacgggtggatgcggccctgttttttagcagccgcaccgcaaccaccttt
tttgaactcttgatctcgcaagctttggaacccgcagagatggtgctggccgcgctaagc
ccagtgaccgctgaacgtatggcctcccttgggtttgctgcccatgttattgcccctcag
gcgacggcagaatctctactccaagccttagccgaccactggaaccgcccgacgctttaa

DBGET integrated database retrieval system