KEGG   Magnetococcus marinus MC-1: Mmc1_0790Help
Entry
Mmc1_0790         CDS       T00427                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mgm  Magnetococcus marinus MC-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
987302..990280
Genome map
AA seq 992 aa AA seqDB search
MKLHFEPDLDYQLAAIESVCALFRGQEIGRTEFTVTLPSGTLDYGEDRLGIGNRLKMLED
EVHANLKEAQLRNGLRPASSLATMDFTVEMETGTGKTYVYLRTIFELHRRYGFTKFVIVV
PSVAIKEGVYKSIQIMEEHFRGLYANAPFEYFLYDSGKLGQVRNFATSPNIQIMVVTVGA
INKQDVNNLYKESEKTGGEKPIDLVRATRPVLIVDEPQSVDGGLTGKGKAALSEMHPLCT
LRYSATHVDKHHMIYRLDAVDAYERRLVKQIEVASLEVEGGHNKPYLRLLSVSNTRGRIA
AKVEVDALQGKAVRRKTVTVQDGDDLEQITERSLYADHRIGEIRVAKGDEFLEVRIPGSE
TFLRLGEAIGDVDQEEMKRQMIRRTIKEHLDKEKRLRPLGIKVLSLFFIDSVANYRAYDA
EGNPAKGPYAEIFEKEYRRWIRHPDYNTLFREVDTETLPAQVHDGYFSIDKKGSWTDTAE
NNQANRESAERAYTLIMKDKERLLGFETPLKFIFSHSALREGWDNPNVFQICVLRDMGSE
LARRQSIGRGLRLCVNQNGERQRGFDINTLTVIATESYEQFAETLQKEIEADTGIRFGVV
EKHQFATIPVTDEHGRQSPLGVEKSEALWKHLHATGYVDTKGKVQDALRTALKEGTLDVP
EAFNAQAPQIQEILKKLAGRLEIKNADERESVRVRKEVLCSPEFQALWDRIKHKTTYRVE
FDNDRLLEECAKAIGSAPPVSRARLQISKADLAIGKGGVQAKETSKAAPITIDERDIELP
DLLSVLQDNTQLTRRSIVRILTGSGRLSDFAHNPQQFIELATEAINRAKRLALVDGIRYQ
RIGDDQFYAQELFEQEELTGYLKDMLKDAKKSVFEHVIYDSGGVERLFAEQLERNEAVRV
YAKLPGWFKVPTPLGTYNPDWAVLVEKDGEERLYFVVETKGRVEGQLFADDLRDKEKAKI
ACGKAHFKALAVGENPARYVVATNSDDLMAQL
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcattttgaaccagacctggattatcaactggcggccatcgagtcggtctgc
gccctgtttcggggccaggagattgggcgaaccgagttcacggtgaccttgccatcgggc
acgttggattatggagaggatcgtcttggcatcggcaaccgcctgaagatgctggaagat
gaagtccacgccaatctgaaggaggcccaactccgcaacgggctgcgtccggcgtcatct
ctggccaccatggattttaccgtggagatggagaccggcaccggcaagacctacgtctac
ctgcgcaccattttcgagttgcacaggcgctacggtttcaccaagttcgtcatcgtcgtc
ccctcggtggccatcaaggagggggtctacaagtcaattcagatcatggaggagcatttt
cggggcctctacgccaacgccccgttcgaatatttcctctacgactccggcaagctggga
caggtgcgcaacttcgccaccagtcccaatatccagatcatggtggtcaccgtcggcgcc
atcaacaagcaggacgtgaacaacctctacaaggagagcgagaagaccggcggcgaaaag
cccatcgatctggtgcgggccacccgacccgtgctgatcgtggacgagccccagagtgtg
gatggtggcctgaccggcaagggcaaggccgccctctccgagatgcaccccctctgcacc
ctgcgctattccgccacccatgtggacaagcaccacatgatctaccgcctcgacgccgtg
gatgcctacgagcgccgtctggtgaaacagatcgaggttgcatccctggaggtggaaggc
ggtcacaacaagccgtatctccggctcctctccgtcagcaacacccggggccggatcgcc
gccaaggtggaagtggacgcgctgcaaggaaaggcggtgcgccgcaaaacggtcacggtg
caggacggggatgacctggagcagatcaccgaacgcagcctctatgcagaccaccgcatc
ggtgaaatccgggtggccaaaggggatgaattcctggaggtgcgcatacccggcagcgaa
accttccttcgtctgggagaggccattggcgacgtggaccaggaggagatgaagcgccag
atgatccggcgcaccatcaaggagcacctggacaaggagaagcgcctgcgccccctcggc
atcaaggtgctgtcactgttcttcatcgactcggtggccaactaccgcgcctacgatgcc
gaaggcaatccggcaaagggtccatacgccgagattttcgagaaggagtaccgccgttgg
attcgccacccggactacaacaccctgttccgcgaggtggacaccgaaacgttgccggcc
caggttcacgacggttacttctccatcgacaagaagggctcctggaccgataccgccgaa
aacaaccaggccaaccgggagagcgccgaacgggcctataccctgatcatgaaggacaag
gagcggcttctgggattcgagacgccgctcaagttcatcttctcccactccgccctgcgc
gagggatgggataaccccaacgtctttcagatctgcgtcctgcgggacatgggctccgaa
ctggcccgccgccaatccatcggtcgcggcctgcgcctgtgcgtcaaccagaacggcgaa
cgccagcggggcttcgacatcaacaccctgacggtcatcgccaccgagagctacgagcag
ttcgccgagacattgcagaaggagatcgaggccgacaccggcatccgcttcggggtcgtg
gagaagcatcagtttgccaccatccccgtcactgacgagcatggccgccagtcccccttg
ggggtcgagaagtcggaggcactctggaaacacctccatgcaaccggctacgtggatacc
aagggcaaggtccaggacgccctgcgtaccgcattaaaggagggaaccctggacgttcca
gaagccttcaacgcccaggccccgcagattcaggagatcctgaagaaactagcggggcgg
ctggagatcaagaatgccgacgaacgggagagcgtcagagtccgcaaggaggtgctgtgc
agccccgagtttcaggccctgtgggatcgcatcaagcacaagaccacctaccgagtagag
ttcgacaacgaccgtctgctggaggagtgcgccaaggccatcggcagtgcgccgccggtt
tcccgcgcccggttgcagattagcaaggcggatctggccatcggcaagggcggcgttcaa
gccaaggagacgtccaaagccgccccgatcaccattgacgagcgggacatcgaactgccc
gacttgctctcggtcctgcaggacaacacccagctgacccgccggagcatcgttcggatt
ctgaccggcagcggtaggctcagcgacttcgcccacaaccctcagcagtttatcgaactg
gccaccgaggcgatcaaccgcgccaaacgcctagccctggtggacggcatccgctaccag
cgtatcggcgacgaccagttctatgcccaggagctgttcgagcaggaggagttgacggga
tacctgaaggacatgctgaaggatgccaagaaatcggtttttgagcacgtcatctacgat
tccggcggcgtggagcggctgtttgcagagcagttggagcggaacgaggccgtcagggtg
tatgccaagctgccgggctggttcaaggtgcctacgcctctgggaacctacaacccggac
tgggcagtgttggtggagaaggacggcgaggaaaggctgtacttcgtggtggaaaccaag
gggcgtgttgaagggcagctgttcgctgacgatctcagggataaggaaaaagccaaaatc
gcctgcggcaaggctcacttcaaggcactggcggtaggcgagaatccagcgcgctatgtg
gtggccaccaacagcgatgacctgatggcgcagttgtaa

DBGET integrated database retrieval system