KEGG   Magnetococcus marinus: Mmc1_0964Help
Entry
Mmc1_0964         CDS       T00427                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mgm  Magnetococcus marinus
Brite
Enzymes [BR:mgm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mmc1_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1179782..1180429
Genome map
AA seq 215 aa AA seqDB search
MDFALARTNMVKSQVQPHEVLDETLLGSMMVVEREQFFPADRQYMAYSDMPITMAPGRRC
LTPMQIAWLIKSAKVTQGSKVLLVGATTGYEAALMAHMGAQVFALECDPGLADKGAELTQ
ALAVSWQVGDLTQGWASAAPFDAIILTGAVEKMPAALAKQLDAYGVMVAVVGQAGAATMS
AVRVIGPTGLHHPERLYETRIDPLPGFAEPVAFQL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggattttgcactggcacggaccaacatggttaaatcccaggtgcagccgcacgaggtg
ttggatgagaccctgctgggctccatgatggtggtggaacgggagcagttttttccggcc
gatcgtcaatatatggcctactccgatatgcccattaccatggctccagggcggcgctgc
ctgacccccatgcagattgcatggttgattaaatcggcaaaggttacgcaagggagcaag
gtgctgctggtgggggcaaccaccggttacgaagcggcgcttatggcccatatgggggcg
caggtgtttgcgctggagtgcgacccaggcttggccgacaaaggtgccgagctaacccaa
gcgctggcggtaagttggcaggtgggggatctgacccaagggtgggccagtgcagccccc
tttgatgccattattctcaccggcgcggtggagaagatgcccgccgccttagccaaacag
ttggatgcctatggtgtgatggtcgcagtggtggggcaggccggtgccgccaccatgagt
gcggtgcgggtcattgggccgaccggtctgcaccatcctgagcggctttatgaaacgcgc
attgatccactgcccggttttgcagagccggtggcttttcagctgtaa

DBGET integrated database retrieval system