KEGG   Magnetococcus marinus MC-1: Mmc1_1480Help
Entry
Mmc1_1480         CDS       T00427                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mgm  Magnetococcus marinus MC-1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mgm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mgm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1808733..1809812
Genome map
AA seq 359 aa AA seqDB search
METVRVLVVDDSPSIRALIKALLADEVGVEVVAEACNGQQAVELNATLLPDIITMDLEMP
VMTGIQAIGEIMRTRAVPILVVSSVSDAEIAYQAVRHGALEVTGKPTLHDGEELAEKLRL
LAGVPVIRHIGIGQQLPSSVDKLLLPQEDLPAPTWLPVAEHHESEVPQPVYVIASSTGGP
NALALLIAALPQGFPYTVLIAQHISDGFAAGMVEWLGQLSAVPVRLGKHGEPILPGVVYI
APSEFHMTVTADGRIAMLTPAEGDIYHPSCDALLRSAAAVYGSRVVGVILTGMGRDGVQG
LAAVCQAGGKTLAQDEASSVIFGMNKLAIEAGVAQEVVSLDNMLPAMLKHAQQSSAEAL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtccgcgtacttgtcgtagatgatagtccctcaatacgggcattgattaag
gcgctgctggcagacgaggtaggtgtcgaagtggtggctgaagcttgcaatggtcagcag
gctgtagagctgaatgcaactttattacccgatattattaccatggatctggaaatgccg
gtcatgacaggcattcaggcgattggtgaaatcatgcgtacccgggcggtgcctattttg
gtggtgagcagtgtaagtgatgctgagattgcctatcaagcggtgcggcacggtgccttg
gaggtaacgggtaaaccaaccctgcatgatggagaagagctggcggaaaagctgcgttta
ttggcgggtgtgccggtgatccgccatattggcatagggcaacagctcccgagcagcgtg
gataagctcttgctgccccaagaggatctcccggccccgacgtggctgcccgtggcagag
caccatgagagtgaagtcccgcagccggtttatgttattgcctcatccaccggtgggcca
aatgctttggcgttgcttattgccgcattgccccagggttttccctataccgtgctcatt
gcccagcatatctccgatggttttgccgctggcatggtggagtggttggggcagcttagt
gcggtccctgtgcgtttgggtaagcatggtgagccgatcttgcccggcgtggtttatatc
gccccctcggaatttcacatgacggttacggcagatggacgcattgccatgctgacgcca
gcggaaggtgacatttaccatcccagttgtgatgcgttgttaaggtcagctgccgccgtt
tatggcagccgggtggttggggttatcctcaccggcatggggcgcgatggggtacagggt
ttggcggctgtttgtcaggctggtggtaaaacattggcccaggatgaggccagttctgtc
atttttggtatgaataaactggcgattgaggccggtgttgcccaggaggtggtgtcgctg
gataacatgctgccagccatgctcaaacacgcccagcagagctctgcggaggcgttataa

DBGET integrated database retrieval system