KEGG   Magnetococcus marinus: Mmc1_1488Help
Entry
Mmc1_1488         CDS       T00427                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
mgm  Magnetococcus marinus
Brite
Enzymes [BR:mgm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mmc1_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DHOR DUF934 DUF1924
Motif
Other DBs
NCBI-ProteinID: ABK43997
JGI: Mmc11488
UniProt: A0L7Q4
Position
1819417..1820385
Genome map
AA seq 322 aa AA seqDB search
MGRWLTVKMVGLALLLSPPVWGVPLINEPIQPIPLTQAELNKQQVALGELLYHDTRLSGD
GTLSCASCHPVNAGGMDGLPVSVGIRQQKGGINAPTVLNARYNLAQFWDGRADSLESQAL
GPVTNPIEMGARWEGVLERLNRDKKMRRRFSELFPHLGITKESISLAIATYERSLTTPNA
PFDRYLRGDLKAVEREVVEGYELFKSYGCVACHQGVNVGGNMYQTFGLFGNYFKDRQIPI
TKSDYGRFNVTAQEEDRFAFKVPSLRNVALTAPYFHDGRVKSLSQAVQLMAHYQLGRQLS
AEHIEKIVAFLHSLTGTQPEAP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggacgttggttgaccgtaaagatggtaggcttggcactgttgctctcgccccccgta
tggggggtgccgttgattaatgagcctattcaacccataccgttgacccaggctgagttg
aataagcaacaggtggcattgggggagctgctctaccacgatacccgcctttcgggtgac
ggcacgttaagctgtgcgagctgccaccccgttaatgcgggggggatggatggtctgccg
gtttctgtaggcatacggcagcaaaaggggggcatcaatgccccaacggtgcttaatgcg
cgctataatttggcgcagttttgggatggccgggccgactctttagagagtcaggcgttg
ggacctgtgaccaaccctattgagatgggggcacgttgggagggggtgttggagcggctt
aatcgagataaaaagatgcgccgtcgttttagtgagctgtttccccatttaggtatcacc
aaggagagcattagtcttgctattgccacctatgagcgtagcttgaccacccctaacgcc
ccctttgatcgctatttaagaggggatctaaaggcggtggagcgggaggtggtcgagggt
tatgagctctttaaatcttacggctgtgtggcgtgtcaccagggggtcaatgtgggcggt
aatatgtaccaaacctttggcctgtttggtaactattttaaagaccgccagataccaatc
accaagagtgattatggccgctttaatgtaaccgcgcaggaggaggaccgttttgccttt
aaagtaccttcgctgcgcaatgtggccctaaccgcgccctattttcacgatgggcgtgtt
aagagcctgtcgcaggcggtgcaattaatggcccactatcagctaggccgccagctaagt
gcagaacatatagaaaaaattgtcgcttttttgcatagcctaaccggtacccagccggag
gccccatga

DBGET integrated database retrieval system