KEGG   Magnetococcus marinus: Mmc1_1518Help
Entry
Mmc1_1518         CDS       T00427                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mgm  Magnetococcus marinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmc1_1518
Enzymes [BR:mgm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mmc1_1518
Exosome [BR:mgm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmc1_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1856051..1858237
Genome map
AA seq 728 aa AA seqDB search
MNQPLSEPMQRLVEARHHDPFELLGRHPDGKGGVLVRVYMPYAEQVRILERGTQQVLNMQ
RIDGSDFFEWQGQLEQVADDYRLMWKDKWGYEHLNRDPYAQLPMVSDFDLYLFNQGNHTQ
IQNFLGSHVMQDAHGAGVRFSVWAPNAERVSVVGDFNHWDGRCHPMRVLPNSGVWELFIP
DLEPGGYYKFEVRDRLGVIHLKTDPMARQNQLRPETASVITPPSSFEWTDAAWLERRKDW
DWQSAPISIYEMHPGSWQRGCEGEFLNYREMAHQLVPYLQELGFTHVELMPITEHPFDLS
WGYQATGYFAPTRRFGRPDDFRYFVDYLHSHHIGVLLDWVPAHFPKDAHGLARFDGTPLY
EHADPRLGEHLDWNTYIFNFGRNEVKSFLISSAMFWLNEFHLDGLRVDAVASMLYLDYSR
EEWIPNIYGGRENIEAVEFMRHLNSLVGRECPGALMIAEESTSWPSVTRPPENGGLGFHM
KWNMGWMNDSLSYIAEDPIHRKYHHDKLTFSLYYAFSENFLLPFSHDEVVHGKGSMIGKM
PGDEWQRFANLRALYLYQFTHPGKKLLFMGTEFGQGNEWNSTTVMEWSLLQYPLHSGMKQ
LVADLNHLYARLPALHKVDFSWQGFQWLDANDGEQSIAAYLRLDGETHVVVVINFTPVVR
RNYRLGVPALSGYREVLNSDSSYYAGSNVGNGQALIMAEEKPWHEQSYSIELTLPPLGGV
VLMPDQAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcccctttctgaaccgatgcaacgtctggttgaagcgcgtcaccatgacccc
tttgaactactagggcggcatcctgatggcaagggtggtgtgctggtcagggtctatatg
ccctatgccgagcaggtgcgcattctggagcggggtacccagcaggtactcaacatgcag
cgcatcgatggcagcgacttttttgagtggcaaggccagctcgaacaggtggccgacgac
tatcgtttgatgtggaaagataagtggggttacgaacatcttaaccgtgacccctacgcc
cagttgcccatggtgagtgattttgacctctatctatttaatcagggtaaccatactcag
attcaaaatttccttggcagccatgtcatgcaggatgcccatggggcaggggtgcgcttt
tcggtttgggcacccaacgccgagcgggtcagtgtggtgggggactttaaccactgggat
ggccgctgtcaccccatgcgggtgctgcccaacagtggggtgtgggagctgtttattcct
gacctagagcccggcggctactataaatttgaagtgcgtgatcgcctgggtgtgatccat
cttaaaaccgatcccatggcacggcagaaccagttacgccctgagaccgcctcggtgatt
accccaccatcttcctttgaatggaccgatgccgcctggctggagcgtcgtaaagattgg
gactggcagagtgcccccatctccatttacgaaatgcaccctggctcctggcagcgtggc
tgtgagggagagttcctaaactatcgcgagatggcccatcaactggtgccctatctgcaa
gagttgggctttacccatgttgagttgatgcccattaccgaacacccctttgatctctct
tggggctatcaggcaaccggctattttgcccccacccggcgctttggccgtcccgacgat
tttcgctactttgtggactatctacacagccaccatattggggttttgctggattgggtg
ccagcgcactttcccaaagatgcccacggtctcgcccgctttgatggcacccccctctat
gaacatgccgatccccgcctaggtgagcatctggactggaacacctacatcttcaatttt
ggtcgtaatgaggtaaaaagcttcctcatctccagtgccatgttttggctcaatgagttc
cacctggatggtctgcgggtggatgccgtggcctccatgctctatctggattattcccgt
gaggagtggatacccaatatctatggggggcgtgaaaatattgaggcggtcgagttcatg
cgccaccttaactcactggtgggacgtgagtgccccggtgcgctcatgattgctgaagag
tcgacctcctggcccagtgtaacccgcccacccgagaatggtggtctgggttttcatatg
aaatggaatatgggttggatgaatgactcgctcagttacatcgccgaggatcccatccac
cgcaaataccaccatgacaagttgaccttcagcctctattacgcctttagcgaaaacttt
ttgttgcctttctcccatgatgaggtggtccacggtaagggttccatgatcggtaaaatg
ccaggggatgagtggcaacgctttgcaaatctgcgcgcgctctacctctatcaatttacc
catccgggtaaaaagctgctgttcatgggcacggaatttggtcagggtaatgagtggaac
tcgaccacggtcatggagtggtccctgctacaataccccttgcatagcggtatgaagcag
ttggtggccgatcttaaccatctttatgcccgcctgcccgccttgcacaaagtggatttt
agctggcaaggtttccaatggttagatgccaatgatggggagcaatccattgcggcctac
ctgcgtctggatggcgaaacacatgtggtggtggtgatcaactttactccagtggtgcgg
cgtaactatcggttgggggttcctgcgctgagtggttatcgcgaggtgctcaatagcgac
tcatcctactatgccggttctaacgtgggtaatggccaagccttgattatggccgaagag
aaaccctggcatgagcaaagctactccattgagttaaccctaccgcctttgggtggggtg
gtgttaatgcccgatcaggcagaataa

DBGET integrated database retrieval system