KEGG   Magnetococcus marinus MC-1: Mmc1_1631Help
Entry
Mmc1_1631         CDS       T00427                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mgm  Magnetococcus marinus MC-1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mgm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mgm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2018258..2019352
Genome map
AA seq 364 aa AA seqDB search
MKTRQAGRYLVVTLAGTRLSEPERAYLQRVEPAGVMLFSRNIEQPEQVVALIRAIRQQSP
STVIWIDQEGGRVQRLRCPLTRLPAAESFAKIYAYAPQQAERLARQCGALAGRELRAFGI
GINCAPVVDIPAPGADPVIGNRAFGDNPLSISRLAGAWLQGLQEAGVMGVAKHFPGHGDA
MVDSHRSLPVVHTEIRELLSRTWVPYVQLLPLLQGIMTAHLVMSALDPLRPATWSSVVLK
DWLRQRLGYGGLIISDALEMGALGGNMEDRAARAVRAGCDQLLVCSGRLNHMQQALNGVQ
QALGEKSPQEQRQDAQRIEAVLQNYRISPGDWQKVVADPAQQALKERLQRMVAADMGRDP
TEVG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcggcaagcggggcgttatttggtcgtcacgctggcaggtacgcgcctgagt
gagcctgagcgggcttatctacagcgtgttgaacctgcgggggtgatgcttttttcgcgc
aatatagagcagcccgagcaggtggtggcgcttatccgggcgattcgccaacagagccca
agcacggtcatctggattgatcaagaaggggggcgggtgcagcgtttgcgttgcccatta
acccgcttacctgcggcggaaagctttgccaagatctacgcatatgccccccagcaggcc
gaacggctggccaggcagtgtggggccctggcaggccgagagctgcgggcgtttggtatt
ggcatcaactgtgcgccggtggtggatattccggcaccgggggcggatccggtgattggt
aatcgtgcattcggggataatccgttgagcatcagccggttagccggggcttggttgcag
gggttgcaagaggcgggggtgatgggggtcgccaagcattttcctggtcatggggatgcg
atggtggattcgcaccgcagtttaccggtggtgcataccgaaataagggaactgctgagc
cgtacgtgggtcccatatgtgcaattgttgcctctgttgcaggggattatgaccgcgcat
ctggtcatgtcggcgttggaccccttacgaccggccacttggtcatcggtggtgttgaag
gattggttgcggcagcggttgggctatgggggcttgatcatctcggatgcgctggagatg
ggtgctttgggcggtaatatggaggatcgcgccgcccgggcagtgcgggccggttgtgac
caactcttggtctgttctgggcggttgaaccacatgcagcaggcgctgaatggggttcaa
caggcgctgggggagaagtctccgcaggaacagaggcaagatgcccagcgtattgaggcg
gtgttgcagaactatcgtatttcaccgggggattggcaaaaggtggttgccgatccggcc
cagcaggcgttaaaagagaggctacagcgtatggtggccgcagatatggggcgcgaccct
acggaagttggctaa

DBGET integrated database retrieval system