KEGG   Magnetococcus marinus: Mmc1_1740Help
Entry
Mmc1_1740         CDS       T00427                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mgm  Magnetococcus marinus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmc1_1740
DNA repair and recombination proteins [BR:mgm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mmc1_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2150656..2151258
Genome map
AA seq 200 aa AA seqDB search
MSSGLPTLERSIELFSRLPGVGRKSAQRMVYHLLKEGGREATLLGQGLLALSERIHFCEV
CHNLAEEGLCAICQDSKRDHGLICVVEEPVDVLAMERAGAYRGLYHVLGGRLSPMDGIGP
DALYLDALLERLQQGGVRELIIATNPTVAGEATAHYITQLAQPLTIDISRLAYGMPMGGE
LEYLDESTLFQALQGRRGVL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcggtctgccgacactggaacgcagcattgagctcttttcccgcctgccaggg
gttggtcgcaagagtgcgcagcgtatggtctaccaccttctcaaagagggggggcgggag
gctactctgctggggcaagggctcttggcgctgagtgagcgcattcacttttgtgaggtg
tgccataatttggccgaagagggcttgtgcgccatttgtcaagatagtaaacgagatcat
ggcctcatttgtgtggtagaagagcccgtggatgtgctagctatggagcgtgctggggct
tatcgaggtctctatcatgtgttgggggggcggcttagccccatggatgggatagggcca
gatgcgctgtacttggacgcgctgctcgagcggttgcagcaaggcggggtacgggagtta
attatcgccaccaacccgaccgttgccggggaggccacggcccactatatcacccaactg
gcgcagccacttaccatagatattagccgcttggcctatggtatgcccatgggcggtgag
ttggagtatttggatgaatccaccctgtttcaggcccttcaaggccgcagaggtgttttg
taa

DBGET integrated database retrieval system