KEGG   Magnetococcus marinus: Mmc1_1747Help
Entry
Mmc1_1747         CDS       T00427                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mgm  Magnetococcus marinus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmc1_1747
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmc1_1747
   00640 Propanoate metabolism
    Mmc1_1747
   00660 C5-Branched dibasic acid metabolism
    Mmc1_1747
Enzymes [BR:mgm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mmc1_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2159150..2160316
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQAKEIIAKFGVNVPRGRVAYTPQEAEMAAKELDSEVFVVKAQIHAGGRGKAGGV
KVVKTTDAVREEASRMLGLTLVTHQTGPEGKEVKRLYVEEGCDIARELYLGIVIDRATSR
VTFMASTEGGMEIEEVAEKSPEKILREVVDPAVGLVAFQARNLAFGLGLEGKQINKAVQL
MSGLYNAFMETDASLMEINPLVITGAGDVIALDCKMNFDANALYRQKAIEELRDFDEENP
KEIEASKHELNYIALDGNIGCMVNGAGLAMATMDIIKIKGGAPANFLDVGGGATTERVTE
AFKLILSDENVKAVLVNIFGGIMRCDVIANGVVEAAKQVNLNVPLIVRLEGTNVEKGKEI
LANSGLPIISADNLDDAATKAVASLKEG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtaccaagccaaagagatcatcgccaagtttggcgtcaatgtccct
cgcgggcgggtagcctataccccccaagaggcagagatggcggccaaagagctggacagt
gaggtctttgtggtgaaagcccagatccacgcgggtggacgtggtaaagcgggcggcgtg
aaggtggtaaaaaccaccgatgccgtgcgtgaagaggctagccgcatgcttggcttgacg
ttggtgacccatcaaaccggtcctgagggtaaagaagttaaacgcctctacgtggaagag
gggtgtgacattgcccgggaactctatttgggtattgtgattgatcgggcgaccagccgt
gtcacctttatggcctccactgaggggggaatggagattgaagaggtcgctgagaagagc
ccagagaaaattctgcgtgaagtggtcgacccagcggttggcttggttgctttccaagcc
cgcaacctggcgtttgggttgggactggaaggtaagcagattaacaaggcggtgcagctg
atgagcggcctctataatgcgtttatggagaccgacgcctccctgatggagatcaaccca
ttggtgatcaccggtgctggggatgttattgcgctggattgcaaaatgaattttgacgcc
aatgcgctctatcgccaaaaagctattgaagagctgcgggattttgatgaagagaatcct
aaggagatcgaagcttctaagcacgagctaaactacatcgctctggatggcaatattggt
tgcatggtcaacggggccggtttggccatggcgaccatggatattatcaagataaagggt
ggcgcaccggccaactttttggacgttgggggtggtgccaccacagagcgggtcacagaa
gcgtttaagctgattctctccgatgaaaatgtaaaagcagttctggttaacatctttggt
ggcatcatgcgctgtgatgtgattgccaatggtgtggtggaggcggcaaagcaggtgaat
ctgaatgttcccctgatcgtccgtttggaaggcaccaatgtggagaagggcaaagaaatt
ttggccaactcgggtctgccgatcatctctgccgataacttggacgatgccgcgaccaaa
gcggtagcctcgctgaaggagggctaa

DBGET integrated database retrieval system