KEGG   Magnetococcus marinus: Mmc1_1747Help
Entry
Mmc1_1747         CDS       T00427                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00020  Citrate cycle (TCA cycle)
mgm00640  Propanoate metabolism
mgm00660  C5-Branched dibasic acid metabolism
mgm01100  Metabolic pathways
mgm01110  Biosynthesis of secondary metabolites
mgm01120  Microbial metabolism in diverse environments
mgm01130  Biosynthesis of antibiotics
mgm01200  Carbon metabolism
Module
mgm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmc1_1747
   00640 Propanoate metabolism
    Mmc1_1747
   00660 C5-Branched dibasic acid metabolism
    Mmc1_1747
Enzymes [BR:mgm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mmc1_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABK44255
JGI: Mmc11747
UniProt: A0L8G2
Position
2159150..2160316
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQAKEIIAKFGVNVPRGRVAYTPQEAEMAAKELDSEVFVVKAQIHAGGRGKAGGV
KVVKTTDAVREEASRMLGLTLVTHQTGPEGKEVKRLYVEEGCDIARELYLGIVIDRATSR
VTFMASTEGGMEIEEVAEKSPEKILREVVDPAVGLVAFQARNLAFGLGLEGKQINKAVQL
MSGLYNAFMETDASLMEINPLVITGAGDVIALDCKMNFDANALYRQKAIEELRDFDEENP
KEIEASKHELNYIALDGNIGCMVNGAGLAMATMDIIKIKGGAPANFLDVGGGATTERVTE
AFKLILSDENVKAVLVNIFGGIMRCDVIANGVVEAAKQVNLNVPLIVRLEGTNVEKGKEI
LANSGLPIISADNLDDAATKAVASLKEG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtaccaagccaaagagatcatcgccaagtttggcgtcaatgtccct
cgcgggcgggtagcctataccccccaagaggcagagatggcggccaaagagctggacagt
gaggtctttgtggtgaaagcccagatccacgcgggtggacgtggtaaagcgggcggcgtg
aaggtggtaaaaaccaccgatgccgtgcgtgaagaggctagccgcatgcttggcttgacg
ttggtgacccatcaaaccggtcctgagggtaaagaagttaaacgcctctacgtggaagag
gggtgtgacattgcccgggaactctatttgggtattgtgattgatcgggcgaccagccgt
gtcacctttatggcctccactgaggggggaatggagattgaagaggtcgctgagaagagc
ccagagaaaattctgcgtgaagtggtcgacccagcggttggcttggttgctttccaagcc
cgcaacctggcgtttgggttgggactggaaggtaagcagattaacaaggcggtgcagctg
atgagcggcctctataatgcgtttatggagaccgacgcctccctgatggagatcaaccca
ttggtgatcaccggtgctggggatgttattgcgctggattgcaaaatgaattttgacgcc
aatgcgctctatcgccaaaaagctattgaagagctgcgggattttgatgaagagaatcct
aaggagatcgaagcttctaagcacgagctaaactacatcgctctggatggcaatattggt
tgcatggtcaacggggccggtttggccatggcgaccatggatattatcaagataaagggt
ggcgcaccggccaactttttggacgttgggggtggtgccaccacagagcgggtcacagaa
gcgtttaagctgattctctccgatgaaaatgtaaaagcagttctggttaacatctttggt
ggcatcatgcgctgtgatgtgattgccaatggtgtggtggaggcggcaaagcaggtgaat
ctgaatgttcccctgatcgtccgtttggaaggcaccaatgtggagaagggcaaagaaatt
ttggccaactcgggtctgccgatcatctctgccgataacttggacgatgccgcgaccaaa
gcggtagcctcgctgaaggagggctaa

DBGET integrated database retrieval system