KEGG   Magnetococcus marinus: Mmc1_1835Help
Entry
Mmc1_1835         CDS       T00427                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mgm  Magnetococcus marinus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmc1_1835
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mmc1_1835
Enzymes [BR:mgm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mmc1_1835
Two-component system [BR:mgm02022]
 CheA family
  CheA-CheYBV
   Mmc1_1835
Bacterial motility proteins [BR:mgm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mmc1_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2278364..2279494
Genome map
AA seq 376 aa AA seqDB search
MKQPIRIVIIEDSAVVSMLLKAILNNEADMEVVGVAADGREGVRLVSELRPDLITMDIRM
PVMDGFEATREIMSSHPTPIVVISSSVDDEELKITFRAIEVGALSVLEKPHGPGNPQFES
NRREIVEMVRAMADVKVFRHQRYRGERVGAGVGSSPAPTSSCSCSSMPSSRSPAQPFELV
AVGASTGGPQALHALLRNLPADFPLPICVVQHISPGFVGGLIQWLNTDSALRVKMAEQGE
LLRAGQVYFAQDGKHLQVNRAMDGGLQAGYVLEPESLHRPAVDQLFNSVARECGAMAIGV
ILTGMGDDGAKGMKRMQERLAMTIAQDEASCVVAGMPRSAVKCGAVKEIVEMDRVGPRLI
ELTLPMRLIKKSMVFS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacccatacgtattgtcattatcgaggattctgccgtcgtctctatgctgtta
aaggcgatccttaacaatgaagcggatatggaagtggttggggtcgcagcggatggtcgt
gaaggggtgcgccttgtgagtgagttgcgcccagacttgattaccatggacatacgcatg
ccggttatggatgggtttgaggccacccgggagattatgtccagccatcccacccccatc
gtggtgattagttccagtgtggatgatgaggaattaaagatcacctttcgtgccattgag
gttggcgcactttctgttctggaaaaaccccatggtcctggcaacccacagtttgaaagc
aaccgccgcgaaattgtcgaaatggtgcgggctatggcggatgttaaagtattccgccac
cagcgctatcggggagagcgggtcggggctggggtagggagtagccctgctccaaccagc
agctgttcgtgttcgtccatgccatccagccgaagccccgcacaaccttttgagctggtg
gcggtaggagcctcgaccggcggcccccaagccttgcatgcactgctacgcaacttacct
gctgattttcctctgcccatttgcgtggttcagcatatttctccaggttttgtggggggg
ttgattcaatggctcaataccgacagcgctcttagggtaaagatggctgaacagggtgag
ttactgcgtgcggggcaggtctattttgcccaagatggtaagcatcttcaggttaatcgt
gccatggacggtggtttgcaggcgggttatgttttggaaccagagagtttgcatcggcca
gcggtagaccagctctttaacagcgttgcccgcgaatgtggtgccatggcgataggggtt
atcctaactggcatgggagatgatggtgctaaggggatgaagcgcatgcaagagcggctg
gctatgaccattgcccaggatgaggcatcctgcgtggtggcgggcatgccccgtagcgcc
gttaaatgtggtgcggtcaaagagatcgtggagatggatagagtaggtcctcgcctaatc
gaactgactctgcctatgcggttgatcaaaaaaagtatggtgttttcatga

DBGET integrated database retrieval system