KEGG   Magnetococcus marinus: Mmc1_1846Help
Entry
Mmc1_1846         CDS       T00427                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00900  Terpenoid backbone biosynthesis
mgm01100  Metabolic pathways
mgm01110  Biosynthesis of secondary metabolites
mgm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mmc1_1846
Enzymes [BR:mgm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mmc1_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABK44354
JGI: Mmc11846
UniProt: A0L8R1
Position
2290717..2291877
Genome map
AA seq 386 aa AA seqDB search
MSSKGIAILGSTGSIGVNTLDVCAQHPDRYRVVALSAGQNSARMIAQAKHFRPEVVAMAD
TKAAAEVTEALAGENIRVLAGEEGVIEVASWASAQMTVSAIVGGAGLRPTLAAIRARKDI
ALANKECLVMAGSLFMAEIGRYQVRLIPVDSEHSAIFQVFQNSNWMRRLVLTASGGPFRG
WRRQQLHGVTPAQAVAHPNWSMGRKISVDSSTMMNKGLEVIEAHWLFGLPAEQIDVVVHP
QSIVHSMVEYQDGSVLAQMGVPDMRTPIAVALAWPERIPTTVKSLDLPKLGQLDFYDKPD
KRDFPCLELAYEALRRGGIAPVVLNAANEIAVAAFLEGAIGYLEIADLIVKTMDYLGHAP
IESIDHLFAVDLQARMTAQQLGRLAH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagcaaggggatcgccatattgggctccacgggctccattggagtcaataccttg
gatgtctgcgcccagcatccggatcgctaccgagtggtggcactcagcgcagggcaaaac
agcgcccgcatgattgcacaggccaagcattttcggcccgaagtggttgccatggccgac
accaaggccgccgcagaggtaaccgaagcattggcaggggaaaatatccgagttttagcg
ggcgaagagggggtgatcgaggtcgccagttgggcgtcggctcagatgacggtttcggcc
attgtcggtggggcggggttgcgccccacattggcagccattcgggcgcgtaaagatata
gccttggccaacaaagagtgtctggttatggcgggcagtctctttatggccgagattggt
cgctatcaggtacgtctgatcccggttgactcagaacacagcgccatttttcaggtcttc
cagaacagtaactggatgcgccggttggtgttaaccgcctcaggtggcccgtttcgaggc
tggagacgccagcagttgcatggggtcacccccgcccaagcggtggcacaccccaattgg
agcatggggcgtaaaatctccgttgactcctccaccatgatgaataaggggctggaggtc
attgaggcccattggctctttggtttgcccgctgaacagattgatgtggtggtgcaccca
cagagcattgtgcactctatggttgaatatcaggatggctcggtgttggcgcagatgggg
gttccggatatgcgcacccccattgcggtggcgctggcttggccggagcgcattccaacc
acggtgaagagtctggacctgccaaaattggggcaacttgacttctatgataaaccggat
aagcgtgattttccctgccttgagttggcctacgaggcactgcgacggggaggtattgcg
ccggttgtgctcaatgccgccaatgaaatcgccgtggcggcttttctggaaggggcgatt
ggctatcttgagattgctgatttgattgtgaaaaccatggattatttagggcatgcgccc
attgagagcattgatcatctgtttgcggtagatcttcaggcacgcatgacggcacagcag
ttggggcgtttggcccattaa

DBGET integrated database retrieval system