KEGG   Magnetococcus marinus: Mmc1_1885Help
Entry
Mmc1_1885         CDS       T00427                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgm  Magnetococcus marinus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmc1_1885
   01230 Biosynthesis of amino acids
    Mmc1_1885
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmc1_1885
   00051 Fructose and mannose metabolism
    Mmc1_1885
   00562 Inositol phosphate metabolism
    Mmc1_1885
Enzymes [BR:mgm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmc1_1885
Exosome [BR:mgm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmc1_1885
  Exosomal proteins of bladder cancer cells
   Mmc1_1885
  Exosomal proteins of melanoma cells
   Mmc1_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2343687..2344454)
Genome map
AA seq 255 aa AA seqDB search
MRRALIAGNWKLNGTTQAATALATAVRDGVAANKPDCDVLVCPTFTVLSAVQGVVAGSGV
DLGAQNMAVASSGAFTGEISGEMLKDVGCSYVILGHSERRTLFGETNEQVAQKVASAYRD
GLTPILCVGETLEQREAEQTMQVLEQQLLACLPVLPADAAKQQQLVVAYEPVWAIGTGKV
ASTAQAQEAHAFIRGLLAKELGANVADAVRILYGGSMKPDNAKELLGQADVDGGLIGGAA
LKANDFLAIMDGLTA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgagctttaattgctggtaactggaagttgaacggtacgacccaagcggccaca
gccctagccaccgctgtgcgggatggtgtggccgcaaacaagcccgattgcgatgtattg
gtgtgccccacctttaccgtgctcagtgcggtgcagggggttgtggccggttcaggtgtg
gatcttggtgcgcaaaatatggctgttgccagcagtggcgcgtttaccggtgagatctcc
ggtgagatgctcaaggatgttggctgtagctatgtgatcctgggccattctgagcggcgc
acgctgtttggtgaaaccaatgaacaggtggcacaaaaggtagcctctgcctatcgggat
ggtttgacccccattctttgcgtgggtgagaccctagagcagcgtgaagcggaacagacc
atgcaggtgttggagcaacaactgctggcctgcttgccggtgctgcccgctgatgcggca
aaacagcagcaactggtggtggcgtatgaaccggtttgggccattggcaccggaaaagtg
gccagcaccgcccaggcgcaagaagcccatgcctttatccgtggtctgctggctaaagag
ttgggggccaatgtggccgatgcggtacgtattctctatggcggttccatgaaacccgat
aatgccaaggaattgttgggacaagccgatgtggatggcggtttgatcggcggggcagca
ttaaaggcgaatgatttccttgccatcatggatggtttaacggcataa

DBGET integrated database retrieval system