KEGG   Magnetococcus marinus: Mmc1_2333Help
Entry
Mmc1_2333         CDS       T00427                                 

Definition
tyrosyl-tRNA synthetase (EC:6.1.1.1)
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
mgm  Magnetococcus marinus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mmc1_2333
Enzymes [BR:mgm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Mmc1_2333
Amino acid related enzymes [BR:mgm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Mmc1_2333
Transfer RNA biogenesis [BR:mgm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mmc1_2333
 Prokaryotic Type
    Mmc1_2333
Mitochondrial biogenesis [BR:mgm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mmc1_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2968666..2969880)
Genome map
AA seq 404 aa AA seqDB search
MKPVKEQMAIIQRGIVDLVSAEQLEQKLTRSLASGVPLRIKAGFDPTAPDLHLGHTVLLH
KLRQFQELGHQVLFLIGDFTAQIGDPTGKSETRKSLTPADVASNAETYKEQVFKLLDAQR
TEVVFNSSWMGQLRASDMIKLAAQFTVARMLERDDFSKRYKEGRPIAIHEFLYPLVQGYD
SVALEADVELGGTDQLFNLLVGRELQKDAGQEPQCVITLPILEGLDGVNKMSKSLNNYIG
VKEPAREIFGKCMSISDDLMWRYYELLSDQEMAQITHLRGEVEAGRYHPMEAKKALAAEL
VERFHGAEAAVAARAEFEGMFKKGDLPDDVPELTVKAEGANLGLAALLCQAGLVKSNGEG
MRMISQNAVSVEREKVSDGRYELARGSRSLIQVGKRRFAYVTVE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggtcaaagagcagatggcgatcattcagcgcggtatcgtggatctggtttcc
gctgagcagctggagcaaaaattgacccgctctttggcgagtggggtgccactacgcatc
aaagccggttttgatcccaccgccccagatctgcatctgggtcatacggtgctactgcac
aagctgcgccagtttcaggagttgggccatcaagtgctctttttgatcggcgattttacc
gcccaaattggggatcctaccggtaaaagcgagacccgcaaatcccttaccccagcggat
gtcgcaagcaatgccgagacctacaaagagcaggtgttcaaactgctggatgcccagcgt
accgaggtggtatttaacagtagctggatggggcaactgcgtgcgtcggatatgatcaaa
ttggcggcgcaatttaccgtggcacgcatgctggagcgggatgacttttccaaacgctat
aaagaaggacggccgattgccatccatgaatttctctacccgctggtgcaggggtatgat
tcggtcgcgctagaagccgatgtagagttgggggggactgaccagctcttcaacctgctg
gtggggcgtgagctgcaaaaggatgccggacaggagccccagtgtgtcatcaccctgccc
attttagaggggctggatggggtcaacaaaatgtccaaatcccttaataattatattggg
gttaaagagcctgcgcgggagatttttggtaaatgcatgtcgatttccgacgatcttatg
tggcgttattatgagctgctgtcggatcaggaaatggcccagatcactcacctgcgcggt
gaggtagaggcgggtcgttaccacccgatggaggccaaaaaagcgttggcggccgagctg
gtggagcgttttcatggggcagaggctgcggttgccgctcgggcagagtttgagggcatg
tttaaaaagggcgacctgcccgacgatgtgcccgagctgacggttaaggccgaaggggca
aacctaggattggcagccctgctttgccaagcgggtttggttaaatccaatggcgagggc
atgcgcatgatcagccaaaatgcggtatcggtggagcgggaaaaggtgagtgatggacgc
tatgaactggcccgtggcagccgtagtctgatccaggttggcaagcgtcgttttgcctat
gttaccgtagaataa

DBGET integrated database retrieval system