KEGG   Magnetococcus marinus: Mmc1_2396Help
Entry
Mmc1_2396         CDS       T00427                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00020  Citrate cycle (TCA cycle)
mgm00310  Lysine degradation
mgm01100  Metabolic pathways
mgm01110  Biosynthesis of secondary metabolites
mgm01120  Microbial metabolism in diverse environments
mgm01130  Biosynthesis of antibiotics
mgm01200  Carbon metabolism
Module
mgm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mgm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mmc1_2396
  Amino acid metabolism
   00310 Lysine degradation
    Mmc1_2396
Enzymes [BR:mgm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mmc1_2396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H DUF1631
Motif
Other DBs
NCBI-ProteinID: ABK44896
JGI: Mmc12396
UniProt: A0LAA3
Position
3053282..3054622
Genome map
AA seq 446 aa AA seqDB search
MATEIKVPTLGESVTEATVVQWLKQVGDAVAVDEPLVELETDKVTVEMPSPVAGVITEIY
AGVDADVEVGAVLCVVDAQGSARVAVPAKPAAEPAPAPAVATAATPAPAVATPAPTVPVA
PPSGGAALSPAVRKLLAEHGLDATQIPATGSGGRLTKGDVLAYLEQPKPAPTAAPTPAPT
AAPTPAPTPTPAPAPMATPALAPAAQLPPAVEGPREERVKMSRLRQRIAQRLKEAQNTAA
MLTTFNEVDMTAVMALRSQYKEVFEKRNHARLGFMSFFVKAAISALQEFPAVNAEIQGNE
IVFKNYYDIGVAVGSPQGLVVPVLRGADAMSLAGIESTIAGMGKRARDGQLSMEEMSGGT
FTITNGGIFGSLLSTPILNTPQSAILGMHKIQQRAMVMPDGSIQARPMMYLALSYDHRIV
DGKEAVSFLVRIKDCIEDPARILLNA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggaaatcaaggtgcccacacttggtgaatcggtaaccgaggccactgtcgta
cagtggctcaaacaggtcggcgatgccgttgctgttgacgagcccttggtggagttggaa
accgataaagttacggtcgagatgccctcgccggtggccggagttattaccgaaatttac
gcgggtgtggatgccgatgtcgaggtcggggccgtgctctgcgtggtggatgcccagggc
agcgcccgcgtagccgtccccgccaaaccggcggctgagcctgccccggctccagcggtg
gcgacagccgcgacacccgcgccagcggtggctacaccggccccaaccgtgccggttgcc
ccccccagcggcggagccgccctctccccagcggtgcgtaaactgctggctgaacatggc
ctagatgccacgcaaataccggcaacgggtagcggtggacgactcacaaaaggggatgta
ttggcctatcttgagcagccaaaacctgctccaacggcggcaccaacccctgctccaacg
gcggcaccaacccctgctccaacgccaacaccggcccccgctccaatggccaccccggca
ctcgccccggcagcgcagctgccccccgccgtcgaaggcccccgcgaagagcgggtcaag
atgtcgcgcctgcgtcaacgcattgcccagcgtttgaaggaggcgcaaaacaccgccgcc
atgctcaccacctttaatgaggtagacatgacggcggttatggcgctgcgcagccaatac
aaagaggtgtttgaaaagcgcaaccatgcccgtttgggttttatgtccttcttcgttaaa
gcggccatctcggcactccaggagtttcctgcggtcaatgctgagatccagggtaacgag
attgtctttaaaaactactatgacattggtgtcgcggtgggctcaccccagggcttggtg
gtcccggtcctacggggggcggacgccatgtcgttggcgggcattgaatccaccatcgcg
ggcatgggcaaacgggcccgtgatggccaactctccatggaggagatgagtggcggcacc
tttaccatcaccaatggcgggatctttggctccctgctctccacgcccattcttaatacg
ccccagtcggcgattttgggcatgcacaaaattcaacaacgcgccatggtcatgccggat
ggctccatccaggcccgtcccatgatgtatctggcactctcttacgaccaccgcattgtg
gatggtaaagaggcggtgagttttctggtgcgcatcaaagattgcatcgaggatcccgcg
cggattctgctcaacgcctaa

DBGET integrated database retrieval system