KEGG   Magnetococcus marinus: Mmc1_2635Help
Entry
Mmc1_2635         CDS       T00427                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mgm  Magnetococcus marinus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mmc1_2635
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mmc1_2635
Enzymes [BR:mgm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mmc1_2635
Two-component system [BR:mgm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mmc1_2635
Bacterial motility proteins [BR:mgm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mmc1_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3331825..3332613)
Genome map
AA seq 262 aa AA seqDB search
MKTDAKESEPQINWPVVGIGSSAGGLEALTSLLGGLDQDVEHSFVIIQHLSPHHRSMMVT
LLERETLLPVRDVQDGLRPARGVIYVTPENHNVILADGRFRLLTPSKQVVPKPSVNLFFR
SLAEELGELAVGVILSGTGSDGAQGVKEIKYAGGTVLVQDPEESKYDGMPRAAIETGVVD
LILPAQTIGKRLMGLALSDSGQLHFSEEGFEQAGVAGLINQLHAWTKIDFSGYKESTLSR
RVQRKRPFLPRIQFVLKVCQAF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatgcgaaagagtcagagccacagatcaattggcctgttgtgggtattggc
tcatcagcgggtggtttggaggcgctgacctccttgttgggtggattggatcaggatgtc
gagcattccttcgtcatcatccagcacctctcccctcaccatcgcagtatgatggtcacc
ctgttagaacgggaaaccctactgcctgtgcgggatgtgcaggatgggctgagacctgcc
cgaggggtgatctatgtgaccccagaaaatcacaatgttatcttggcggatggccgcttt
cgactgttaactccctccaaacaggttgtacccaaaccctcggtgaatctgttctttcgc
tcccttgctgaagagctgggtgagctggccgtcggggtgatcctctccggcactggatcc
gatggggcgcaaggggtcaaagaaattaaatatgctggtggcacggtcttggtgcaggac
ccggaagagtccaagtacgacggcatgccccgcgccgccattgagaccggggtagttgac
ctgatactcccagcgcagaccattggtaaacggctgatggggctggccctctccgattcc
ggtcagttgcacttctctgaagaggggtttgagcaggctggggtggcaggcttgattaac
caactgcatgcctggaccaaaattgacttcagtggctacaaggagagcaccctaagccga
cgggtacagcgtaagcgtccatttctccccaggattcagtttgttttgaaggtgtgtcaa
gctttctga

DBGET integrated database retrieval system