KEGG   Magnetococcus marinus: Mmc1_3024Help
Entry
Mmc1_3024         CDS       T00427                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgm  Magnetococcus marinus
Pathway
mgm00010  Glycolysis / Gluconeogenesis
mgm00030  Pentose phosphate pathway
mgm00051  Fructose and mannose metabolism
mgm00052  Galactose metabolism
mgm00680  Methane metabolism
mgm01100  Metabolic pathways
mgm01110  Biosynthesis of secondary metabolites
mgm01120  Microbial metabolism in diverse environments
mgm01130  Biosynthesis of antibiotics
mgm01200  Carbon metabolism
mgm01230  Biosynthesis of amino acids
mgm03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmc1_3024
   00030 Pentose phosphate pathway
    Mmc1_3024
   00051 Fructose and mannose metabolism
    Mmc1_3024
   00052 Galactose metabolism
    Mmc1_3024
  Energy metabolism
   00680 Methane metabolism
    Mmc1_3024
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mmc1_3024
Enzymes [BR:mgm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mmc1_3024
Protein phosphatases and associated proteins [BR:mgm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mmc1_3024
Messenger RNA biogenesis [BR:mgm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Mmc1_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABK45515
JGI: Mmc13024
UniProt: A0LC22
Position
3783193..3784179
Genome map
AA seq 328 aa AA seqDB search
MSQPKPMNTIAVMTSGGDAPGMNSAIRAVVRTAIGAEMEVLGIRRGYSGLLEGDLIPMDA
ASVGNILQKGGTVLGTSRCAEFLKPEIRQEAANILRRKHVDGLVVIGGNGSFNGAYQLHQ
EHDIPVVGVPGTIDNDIQGTHYTIGFDTAVETGVYAVDKIRDTANAHDRIFLVEVMGRHS
PAIAIHTGVCTGAEHVIHTPENTDYDTLVSGIRRGRKRGKNSFIIIVAEGQVPGSAYQVQ
KHLADNYQIASHVAILGHLQRGGSPTAHDRFIAASMGFHAVQALKTGEVATVTACRDGRI
QLVPLQECLEKNDAIDAFSLNLTQQLAI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacctaagcctatgaataccatcgcggttatgaccagtggcggcgatgctcca
ggcatgaacagcgccattcgtgcggtggtgcgtaccgccatcggtgcagagatggaggta
ctgggcatccgccgcggctacagtggcctgctggaaggggatcttatccccatggatgcc
gcctcggtgggtaatattctacaaaagggtggtactgtgctgggcacctcccgctgcgcg
gagtttcttaaaccggagattcgccaagaagctgccaatattttacgccgtaaacatgtg
gatggcttggtcgtcatcggtggcaatggctcctttaatggcgcctaccaactgcaccaa
gagcatgacataccggtggttggcgtaccgggtaccattgataatgatatccaaggtacc
cactacaccatcggttttgacacggcggtggagaccggggtctatgcggtggataaaatc
cgcgacaccgccaatgcccacgaccgtatttttttggtggaggtcatggggcgacatagc
cccgccatcgccatccataccggtgtctgcaccggggctgaacatgtgattcacaccccc
gaaaataccgactatgacaccttggtctcagggatccggcggggccgtaagcggggcaaa
aactcctttattatcatcgtcgctgaggggcaagttcctggttcagcctatcaggtgcaa
aagcatctggcggacaattatcaaatcgcctcgcatgtggccattttgggccacctgcaa
cgcggcggatcgcccaccgcccatgatcgctttattgccgccagcatgggttttcacgct
gtccaagccctcaaaaccggcgaagtggccacggttaccgcttgccgtgacggacgtatt
cagctggtccccttacaagagtgtttggaaaaaaatgatgccatcgacgctttctcctta
aacctgacccagcagttggcaatctga

DBGET integrated database retrieval system