KEGG   Magnetococcus marinus: Mmc1_3024Help
Entry
Mmc1_3024         CDS       T00427                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgm  Magnetococcus marinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmc1_3024
   01230 Biosynthesis of amino acids
    Mmc1_3024
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmc1_3024
   00030 Pentose phosphate pathway
    Mmc1_3024
   00051 Fructose and mannose metabolism
    Mmc1_3024
   00052 Galactose metabolism
    Mmc1_3024
  Energy metabolism
   00680 Methane metabolism
    Mmc1_3024
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Mmc1_3024
Enzymes [BR:mgm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mmc1_3024
Protein phosphatases and associated proteins [BR:mgm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mmc1_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3783193..3784179
Genome map
AA seq 328 aa AA seqDB search
MSQPKPMNTIAVMTSGGDAPGMNSAIRAVVRTAIGAEMEVLGIRRGYSGLLEGDLIPMDA
ASVGNILQKGGTVLGTSRCAEFLKPEIRQEAANILRRKHVDGLVVIGGNGSFNGAYQLHQ
EHDIPVVGVPGTIDNDIQGTHYTIGFDTAVETGVYAVDKIRDTANAHDRIFLVEVMGRHS
PAIAIHTGVCTGAEHVIHTPENTDYDTLVSGIRRGRKRGKNSFIIIVAEGQVPGSAYQVQ
KHLADNYQIASHVAILGHLQRGGSPTAHDRFIAASMGFHAVQALKTGEVATVTACRDGRI
QLVPLQECLEKNDAIDAFSLNLTQQLAI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacctaagcctatgaataccatcgcggttatgaccagtggcggcgatgctcca
ggcatgaacagcgccattcgtgcggtggtgcgtaccgccatcggtgcagagatggaggta
ctgggcatccgccgcggctacagtggcctgctggaaggggatcttatccccatggatgcc
gcctcggtgggtaatattctacaaaagggtggtactgtgctgggcacctcccgctgcgcg
gagtttcttaaaccggagattcgccaagaagctgccaatattttacgccgtaaacatgtg
gatggcttggtcgtcatcggtggcaatggctcctttaatggcgcctaccaactgcaccaa
gagcatgacataccggtggttggcgtaccgggtaccattgataatgatatccaaggtacc
cactacaccatcggttttgacacggcggtggagaccggggtctatgcggtggataaaatc
cgcgacaccgccaatgcccacgaccgtatttttttggtggaggtcatggggcgacatagc
cccgccatcgccatccataccggtgtctgcaccggggctgaacatgtgattcacaccccc
gaaaataccgactatgacaccttggtctcagggatccggcggggccgtaagcggggcaaa
aactcctttattatcatcgtcgctgaggggcaagttcctggttcagcctatcaggtgcaa
aagcatctggcggacaattatcaaatcgcctcgcatgtggccattttgggccacctgcaa
cgcggcggatcgcccaccgcccatgatcgctttattgccgccagcatgggttttcacgct
gtccaagccctcaaaaccggcgaagtggccacggttaccgcttgccgtgacggacgtatt
cagctggtccccttacaagagtgtttggaaaaaaatgatgccatcgacgctttctcctta
aacctgacccagcagttggcaatctga

DBGET integrated database retrieval system