KEGG   Magnetococcus marinus MC-1: Mmc1_3112Help
Entry
Mmc1_3112         CDS       T00427                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
mgm  Magnetococcus marinus MC-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mgm00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mgm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3879296..3879703)
Genome map
AA seq 135 aa AA seqDB search
MLWSTLIAMACAGVWWFFVRDDLNVGGRLAINHCGMCHDLTARQVMDKGPPLWGLTERPP
GTHPRYDYSPAFLEHVRHHPFEWNREVLEEFLQYPEKVIPGNVMSRTKMGHPNFYQDVDH
SRFRKDLVAYIIQLK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggtccactcttattgcaatggcttgtgcaggggtttggtggttctttgtccgt
gacgatcttaatgtgggggggcgtttagcgatcaaccactgtggcatgtgccacgatctg
accgcacgacaggttatggataaagggccgccgttatggggcttaacagagcgtccaccg
ggtacccacccccgctatgattatagcccggcgtttttagagcatgtgcgccatcaccca
tttgagtggaaccgagaggttctggaagaatttttgcaatatcccgagaaggtcattcct
ggaaatgtgatgtcccgaacgaagatggggcatcccaacttttaccaggatgtggatcac
tcccgttttcgtaaagatctggttgcctatatcattcagcttaaatga

DBGET integrated database retrieval system