KEGG   Magnetococcus marinus MC-1: Mmc1_3193Help
Entry
Mmc1_3193         CDS       T00427                                 

Definition
phosphoglycolate phosphatase (EC:3.1.3.18)
Orthology
K01091  
phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
mgm  Magnetococcus marinus MC-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mgm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3977646..3978398
Genome map
AA seq 250 aa AA seqDB search
MCSAKIIPFPASVVATHGRSQQQPPFPCSALLFDLDGTLVHTGPDLAGAMNHVLQSRGLA
TLDPIEVQHLVGNGARSLLARGFWGRGAEAPEGDSDFEAAVQQFLAYYAHHIADHSHPYP
GVMEGLQRLQEAGFFMAVVTNKPEFLAHKLLAELNMAHFFKVVVGGDTLPTRKPAPEMLY
HATVHMASAINEAVMVGDSDNDILAAQRANIPVIAVNYGYNQHDALAALHPDVLVDCFGA
IEGLVVREQA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcgctaaaatcatcccttttcccgcatctgtcgtcgcgacccacggtcggtcg
caacaacaaccgcccttcccctgtagcgccctgctgtttgatttggatggcaccctggtg
cataccggtcccgatctggcgggagccatgaaccatgttctgcaaagccgggggctggcc
accttggaccccatagaggtccaacatctcgtcggcaatggtgctcgttcgctgctggcc
cggggcttttggggcaggggtgccgaagcccctgaaggggatagcgattttgaggccgcc
gtacagcaatttttagcctattatgcccaccatattgccgaccactcccacccctaccca
ggcgtgatggaggggttgcaacgcttgcaagaggcgggtttttttatggcggtagtgacc
aacaaaccggaatttctagcccacaagctgctagcagagctcaacatggcgcactttttt
aaagtggtggtggggggagatacactacccacccgcaagcccgcaccagagatgctctac
cacgccaccgtgcacatggccagcgccattaacgaggcggtgatggttggggattcggac
aacgatattttggccgctcagcgtgcaaacataccggtgattgcggtcaactatggttac
aaccagcatgatgccttagcggccctgcaccctgacgttttggtggattgttttggggct
attgaagggctggtggtacgcgagcaggcttag

DBGET integrated database retrieval system