KEGG   Magnetococcus marinus: Mmc1_3380Help
Entry
Mmc1_3380         CDS       T00427                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mgm  Magnetococcus marinus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mmc1_3380
Enzymes [BR:mgm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mmc1_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4210440..4212668)
Genome map
AA seq 742 aa AA seqDB search
MSGNPLEQGEGVESFCGRIKQVVFHNLENGYAVMVVRPDEAPEETQTVVGVLAAPAAEMR
LCFHGQWESNAKFGRQFKAERMEPLGTTLREAIVLFLQSGSIKGIGKTMANRLVERFGEA
LFEVMDERPEALLEVRGVGKANHGRILKNWQKARDDAQLMLLLYQLGFGAALTRAVSKCL
READPQADPLKMVQENPYLLAQVRGITFQRADAAALQLGMQRLDPRRIEAGMQEILIQLA
NNEGHTLLEEPRFHQQLTVLLALQGHQDQLNLVPMVLERLDLGQGPLVRVYGRDGSPFVQ
LTRYHDYEKQIAYHISRLHGPSPIETISDGWIERVSRGHFSLSVDQRQALKTITQDKVAI
LTGGPGMGKTTITRYVIEHAVENKQTVKLCAPTGRAAKQLAEATGEVALTIHRLMGKGSD
ESVDGQRKFECDLLVVDESSMMDEWMASSLLQMLPDHCRLLLVGDADQLPSVAAGRVLQD
LIQSGVVPVARLTEVHRQAEGSGIALGAVEILHGRRPQMARDFKFVAVTGGMEHLHQCAN
RMLEGIDKMMRVGGIDGAEIQVITPMHGTEVGVKALNERLHEQLNPYQAGQEVLELDGFA
YRAGCRIMQTKNDYDLELFNGDQGEIVEISKDAQGELQVIAKFDEAQKLLDREQMGNIVP
CYAITVHKSQGGQFNYVVTPVVTAHGKMLYRNLFYTCVTRARKGVVLVGSYEALVMAISY
KENMQRNTGLLSRIEERMGGAV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcaatcctttagagcagggagagggtgtggagagcttttgtgggcgtattaaa
caggtggtcttccataatctggaaaacggttatgcggtgatggtggtgcgcccggatgag
gccccggaggagacccagacggtggtgggggtgttggcggccccggcggcggagatgcgc
ttgtgttttcatggccaatgggagagcaacgccaagtttggtcggcaatttaaggccgag
cgcatggagcccctggggaccaccctgcgggaggctattgtactgtttttgcagagtggc
tccatcaagggcattggcaagaccatggccaaccgcttggtcgagcggtttggtgaagcg
ctgtttgaggtgatggatgagcgtcccgaagcgctgctggaggtgcgtggggtgggtaag
gccaaccatgggcgtatcttaaaaaattggcaaaaagcacgggacgatgcccaactgatg
ctgttgctctatcaactgggttttggtgcggctttgacccgcgcggtcagtaaatgcctg
cgggaagccgatccccaagccgaccccctcaagatggtgcaagagaacccctatctgttg
gcgcaggtgcggggcatcacctttcagcgggccgatgccgccgctctgcaattagggatg
cagcgtttggacccgcgccgtattgaggcgggtatgcaggagattttaatacaattggcc
aataatgaggggcacaccctgctagaagagccccgttttcaccaacagctaacggttttg
ttggccttacaggggcaccaggatcagctcaatttggtgcccatggtgttggagcgtttg
gatcttggtcaggggccgttggtgcgggtatatggtcgggatggcagcccttttgtgcag
cttacccgttaccatgactatgaaaaacagattgcttaccatatcagccgtttgcacggg
ccaagccccattgagaccattagcgatggctggattgagcgggtgagtcgcggccatttt
agcctctcagtggatcagcgtcaggcgctcaagaccattacccaggacaaggtcgccatt
ttaaccggtggtcctggcatgggtaagaccaccatcacccgctatgtcattgagcatgcc
gtagaaaacaagcaaacggttaagctgtgcgcccccacggggcgggcggccaagcagttg
gccgaggctaccggggaggtggctttgaccatccaccgtttaatgggcaagggcagtgat
gagtctgtggatggtcagcgtaagtttgagtgtgatctgctggtggtggatgagagctcc
atgatggatgagtggatggccagttcactgctacagatgttaccggaccactgccgcctg
ttattggtgggggatgccgatcagctaccgtcggttgcagcggggcgtgtgttgcaggat
ttaattcagagtggggtggtgccggtggcgcgcttgacagaggtacaccggcaggcggag
ggttcgggtatcgccttgggggcggtggagattttgcatgggcggcgtccacagatggcg
cgggattttaaatttgtggcggttacgggcggcatggagcatcttcatcagtgtgccaat
cgtatgctggagggcatagacaagatgatgcgcgtggggggcattgatggggcggagatc
caggtgattactcccatgcatggtaccgaggtgggggtaaaggcgctgaacgagcggctc
catgagcagctcaacccctatcaggcggggcaggaggtgttggagttggacggctttgcc
tatcgggcgggttgccgcattatgcagaccaagaatgattatgatctggagctgtttaat
ggggaccaaggggagattgtggagatcagcaaggatgcccagggggagcttcaggtcatt
gccaaatttgatgaggcgcaaaagctgttggatcgggagcagatgggtaacattgtgccc
tgttacgccattactgtgcataaaagccagggtgggcagtttaactatgtggttacgccg
gtggtaacggcccatggtaagatgctctatcgcaacctgttttatacctgtgtgacgcgg
gcgcgtaagggtgtggtcttggtgggctcttatgaggcgttggtgatggcgatctcctat
aaggagaatatgcagcgcaatacgggtctgttgagccgtatcgaggagcgcatgggtggt
gcagtataa

DBGET integrated database retrieval system